KEGG   Lates calcarifer (barramundi perch): 108882928
Entry
108882928         CDS       T04895                                 

Definition
(RefSeq) putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04010  MAPK signaling pathway
lcf04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108882928
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108882928
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lcf04052]
    108882928
   00536 Glycosaminoglycan binding proteins [BR:lcf00536]
    108882928
Cytokines and growth factors [BR:lcf04052]
 Growth factors
  Growth factors (RTK binding)
   108882928
Glycosaminoglycan binding proteins [BR:lcf00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   108882928
SSDB
Motif
Pfam: FGF Fascin Ntox17
Other DBs
NCBI-GeneID: 108882928
NCBI-ProteinID: XP_018531239
UniProt: A0A4W6E6H1
LinkDB
Position
Unknown
AA seq 157 aa
MADEEVFRAEDQTVDGGLLPRDYRRLTRLYCMNGGHHLQILPDGTVQGQRDDGDVHTVLK
IKAVDRGVVVIQGREAGRYLAMSDEGRLYSSPTVTDECYFLEKLEENHYNTYRSQKYQER
NWYVALKKNGKPKLGPRTHIGQKAVFFLPRQLDDSGE
NT seq 474 nt   +upstreamnt  +downstreamnt
atggcggatgaagaagtgttccgggcggaggatcagaccgtggacggcggcctgctgccg
cgggactaccggcggctaactcggctgtactgcatgaatggcggacaccacctgcagatc
ctgcccgatgggacggtgcaggggcagagggatgatggggacgttcacactgttctaaag
atcaaagctgtggacagaggagttgtggtcatccaaggaagagaggccgggagatatttg
gcgatgagcgatgagggacgtttgtacagttcacccacagtcactgatgaatgttacttt
ctggagaaactggaggagaaccactacaacacatatcggtctcagaaatatcaggagagg
aactggtacgtggctctgaaaaagaacggaaaacctaaactgggtccaagaactcacatc
ggacagaaggccgtcttctttctgccccgacagctggacgactccggggagtga

DBGET integrated database retrieval system