KEGG   Lates calcarifer (barramundi perch): 108883075
Entry
108883075         CDS       T04895                                 

Gene name
cdkn1b
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04012  ErbB signaling pathway
lcf04068  FoxO signaling pathway
lcf04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108883075 (cdkn1b)
   04068 FoxO signaling pathway
    108883075 (cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108883075 (cdkn1b)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 108883075
NCBI-ProteinID: XP_018531465
UniProt: A0A4W6CWB2
LinkDB
Position
Unknown
AA seq 185 aa
MSDVRLSNGSPTLERTDPRVSDHPKPSACRSLFGSVDHEELKRDLKGHLREMEETASAKW
GFDFANHTPLVNDRLEWELVDCRDVPDFYNRPLRREKGVCSAGNNNVDLNGNHNCVVVAP
SEDTDRSDGQMECTEQCTGLRKRPACHDPTAQNKRSHTSSDEVSCPSLSHSAEYTPRKTS
PKRQT
NT seq 558 nt   +upstreamnt  +downstreamnt
atgtcagatgttcgactttcaaacgggagcccgacgctggagcggacggacccccgggtt
tcggatcacccgaaaccgtcagcctgcaggagcctcttcggctcggtggatcacgaagag
ttaaagagggatttaaagggacatttgcgggagatggaagagactgcctccgccaagtgg
ggcttcgacttcgccaatcacacgccgctggtcaacgacagactcgagtgggaattagtg
gattgcagagacgtcccggatttctacaaccggccgctccggagagagaagggcgtctgc
tccgctgggaataacaatgtggatctaaatgggaatcataactgtgttgtggtggctccg
agcgaagataccgacaggtctgacgggcagatggagtgcacggaacagtgcaccgggctg
aggaaaagacctgcatgtcacgaccccacggcccaaaataagaggtcacacaccagctca
gatgaggttagttgtccaagtctgagccactctgcagaatacacacccagaaagaccagt
cccaagagacaaacgtga

DBGET integrated database retrieval system