KEGG   Lates calcarifer (barramundi perch): 108883098Help
Entry
108883098         CDS       T04895                                 

Gene name
sod2
Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04068  FoxO signaling pathway
lcf04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    108883098 (sod2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    108883098 (sod2)
Enzymes [BR:lcf01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     108883098 (sod2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 108883098
NCBI-ProteinID: XP_018531498
LinkDB All DBs
Position
Unknown
AA seq 268 aa AA seqDB search
MLQTPPRDINGTVDCAVKLKLLSSRAVTVCLWCLPCPVSTTMNMLCRVGQIRRCAASLSQ
TISQVSAARQKHTLPDLTYDYGALEPHISAEIMQLHHSKHHATYVNNLNVTEEKYQEALA
KGDVTTQVALQPALKFNGGGHINHTIFWTNLSPNGGGEPQGELMEAIKRDFGSFQKMKEK
MSAATVAVQGSGWGWLGYDKESGRLRIAACANQDPLQGTTGLIPLLGIDVWEHAYYLQYK
NVRPDYVKAIWNVISWENVTERLQIAKK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaaacacccccacgtgacattaatggtacggtcgactgcgccgtcaagttgaaa
ctgctcagttcaagggcagttacagtgtgtctatggtgtctgccgtgtcctgtgagcact
accatgaacatgctttgcagagttggtcaaatacgcaggtgtgcagccagcctcagccag
acaataagccaggtatctgcagcaaggcagaagcacacgctccctgacctgacctacgat
tatggagccctggagccccacatcagtgcagagataatgcagctgcaccacagcaagcac
catgccacatatgttaacaacctcaatgttacagaggagaaatatcaggaagcactggca
aagggggatgtgacgacacaggttgccctccagcctgctctcaagtttaatgggggaggc
cacattaaccacactatcttctggacaaacctctctccaaatggtggaggcgagccacag
ggggagttaatggaagccatcaagcgggactttggctccttccagaagatgaaggagaag
atgtctgcagctactgtagcagtgcagggctcaggctggggctggctgggctacgacaag
gagagtggaagactgcgcatcgcagcttgtgctaaccaggatcctctgcaggggacaaca
ggtctcatccctctcctcggtattgatgtatgggagcatgcttactatcttcagtacaaa
aatgtgcggccagactatgttaaggctatctggaatgtaatcagctgggagaacgtgact
gagcgtcttcagattgccaaaaagtag

DBGET integrated database retrieval system