KEGG   Lates calcarifer (barramundi perch): 108883473Help
Entry
108883473         CDS       T04895                                 

Definition
(RefSeq) elongation of very long chain fatty acids protein 1-like
  KO
K10247  elongation of very long chain fatty acids protein 1 [EC:2.3.1.199]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00062  Fatty acid elongation
lcf01040  Biosynthesis of unsaturated fatty acids
lcf01100  Metabolic pathways
lcf01212  Fatty acid metabolism
Module
lcf_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    108883473
   01040 Biosynthesis of unsaturated fatty acids
    108883473
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lcf01004]
    108883473
Enzymes [BR:lcf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     108883473
Lipid biosynthesis proteins [BR:lcf01004]
 Elongase
  PUFA
   108883473
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ELO Nucleos_tra2_C
Motif
Other DBs
NCBI-GeneID: 108883473
NCBI-ProteinID: XP_018532184
LinkDB All DBs
Position
Unknown
AA seq 318 aa AA seqDB search
MLREALSNILKFHNYLQSRTDARVRDYPLMQSPVQMTTILMAYVVFSVYIGPRLMANRKP
FRLNTVMIIYNLSMVLLNAYIVYEFLMSGWATTFTWRCDLIDPSSSPQALRMIRVAWLFY
FSKFIELLDTVFFVLRKKQNQITFLHVFHHSFMPWTWWWGITLTPAGGMGSFHAMVNATV
HVIMYFYYGLSAAGPRFQKYLWWKKYMTAIQLIQFVLVSIHISQYYFMEKCDYQVPLWIH
LIWMYGIFFFLLFSNFWVQAYIKGKRLPATEDKLKLNGSASEPITVVANGKHLGRERENG
KVPYYTNGKIFLGKVKEI
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgagaggcgctatcaaacattttaaaattccacaattatctacaatcaagaact
gatgccagagtcagagactaccctctgatgcagagtcccgttcagatgaccaccatcctg
atggcctacgtcgtcttctcagtgtacatcgggcctcgcctaatggcgaaccgcaaacct
ttccgcctaaacacagtcatgatcatctacaacctcagcatggttttactgaacgcctac
atagtctatgagttcctgatgtcgggatgggctaccaccttcacatggagatgtgaccta
attgacccctccagcagcccgcaggctcttaggatgattcgagtggcttggttgttttat
ttttctaaattcattgaactccttgacacagtattctttgtgttgaggaagaaacaaaac
caaatcacatttctccatgtattccatcactccttcatgccctggacgtggtggtggggc
atcactctgactcctgccggaggaatgggctccttccatgccatggtgaacgcaacagtc
cacgttatcatgtacttctactatggactttctgctgcaggacctcgcttccagaaatac
ctgtggtggaagaagtatatgactgccatccagcttatacagtttgttctggtctccatt
cacatcagccagtactacttcatggagaagtgtgactaccaggtcccgttatggatccac
ttgatctggatgtatggcatcttcttcttcctcctcttctccaacttttgggtgcaggcc
tacattaagggcaaacggcttcctgccacagaggacaagctaaaactgaacggctccgcc
agtgaacccatcactgtggtggccaacggcaaacacctgggaagagaacgggagaatgga
aaggtgccctattacaccaacggcaaaatcttcctgggcaaagtaaaggaaatctaa

DBGET integrated database retrieval system