KEGG   Lates calcarifer (barramundi perch): 108884212Help
Entry
108884212         CDS       T04895                                 

Definition
(RefSeq) pancreatic alpha-amylase-like isoform X1
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00500  Starch and sucrose metabolism
lcf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    108884212
Enzymes [BR:lcf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     108884212
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 108884212
NCBI-ProteinID: XP_018533475
LinkDB All DBs
Position
Unknown
AA seq 527 aa AA seqDB search
MFCLSGEWFSHSSRKMKLLILVALFGLSLAQHNPHIRYGRTTIVQLFEWRWADIAAECER
FLGPNGFGGVQISPPSEHIVLNSPWRPWWQRYQPISYNLCSRSGSENELRNMITRCNNVG
VNIYVDAVINHMCGAGGGEGTHSSCGSWFNAGKRDFPSVPYSAWDFNDHKCRTGSGDIEN
YGDAYQVRDCRLVSLLDLALEKDYVRGKVAEYMNKLVDMGVAGFRVDACKHMWPGDLAVV
YGRLRNLSTKWFPAGSRPFIYQEVIDLGGEPISSREYVHLGRVTEFKYGAKLGTVFRRWH
GEKLCYTRNWGEGWGFMADRDALVFIDNHDNQRGHGAGGASIISFWDSRLHKMAVGYMLA
HPYGVARVMSSYRWDRHFVNGKDQNDWVGPPSHADGSTKSVPINPDQTCGDGWVCEHRWR
QIKNMVIFRNVVNGQPHSNWWDNQSNQVAFGRGNRGFIVFNNDDWDLDVTLNTGMPGGTY
CDVISGQKEGNRCTGKQIHVGGDGRAHFRISNRDEDPFVAIHAESKL
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgttctgtctgagtggagagtggttttctcattcatccaggaaaatgaagttgttgatt
ctggtggctctgtttgggctcagcctcgcccagcacaaccctcacatcaggtacggaagg
acaaccattgtccaactgtttgaatggcgctgggccgacatcgctgctgagtgtgagcgc
tttttgggtcccaatggctttggtggagttcagatctcccctccaagtgagcacattgtg
ctgaacagtccctggaggccctggtggcagagataccagccaatcagctacaacctgtgc
tccagatctggcagtgagaacgagctgagaaacatgatcaccagatgcaacaatgtcggg
gtcaacatctatgtggatgctgtcatcaaccacatgtgtggagctgggggtggagaggga
acccactcctcatgtggaagctggttcaatgcaggcaaaagggacttccccagtgtcccc
tattctgcctgggacttcaatgatcacaaatgcaggactggtagtggtgacattgagaat
tatggtgatgcctatcaggttcgtgactgccgtctggtcagtctgttggacctcgccctg
gagaaagattacgttaggggcaaggtggcagaatacatgaacaagctggttgacatgggt
gtggctggattcagagtggatgcctgcaagcacatgtggcctggcgacctggcagttgtc
tatggtcgcctgcgcaacctcagcaccaagtggttccctgctggctccagaccctttatc
taccaagaggttattgatctgggaggtgagcccatctcatccagagagtacgtccatctg
ggaagggtaactgagttcaaatatggtgccaaactgggaactgtcttcagaagatggcat
ggtgagaaactgtgttacaccaggaattggggagagggttggggtttcatggccgaccgt
gatgctcttgtcttcattgataaccatgacaaccagaggggccacggtgctggtggtgca
tcaattatttccttctgggactccaggcttcacaagatggccgttggctacatgctggcc
cacccttatggagtagccagggtgatgtctagctaccgctgggaccgccactttgtgaat
ggaaaggatcagaatgactgggtgggtcctcccagccatgctgacggatccaccaagtct
gttcccatcaaccctgaccagacttgtggagatggatgggtgtgtgagcacagatggcgt
cagatcaagaacatggtcattttccgtaacgtggttaacggacagcctcactccaactgg
tgggacaaccagagcaaccaggttgcctttggacgtggtaatcgtggcttcatcgtcttc
aacaatgatgactgggacctggatgtgaccctgaacactggcatgcccggtggcacctac
tgtgacgttatctctggccagaaggaaggaaacagatgcactgggaagcagatccacgtt
ggaggtgatggtcgtgcccacttcaggatcagcaacagagatgaggacccctttgttgct
atccatgccgaatccaagttgtaa

DBGET integrated database retrieval system