KEGG   Lates calcarifer (barramundi perch): 108884291Help
Entry
108884291         CDS       T04895                                 

Gene name
parp2
Definition
(RefSeq) poly [ADP-ribose] polymerase 2
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf03410  Base excision repair
lcf04210  Apoptosis
lcf04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    108884291 (parp2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108884291 (parp2)
   04217 Necroptosis
    108884291 (parp2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lcf03032]
    108884291 (parp2)
   03036 Chromosome and associated proteins [BR:lcf03036]
    108884291 (parp2)
   03400 DNA repair and recombination proteins [BR:lcf03400]
    108884291 (parp2)
Enzymes [BR:lcf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     108884291 (parp2)
DNA replication proteins [BR:lcf03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     108884291 (parp2)
Chromosome and associated proteins [BR:lcf03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    108884291 (parp2)
DNA repair and recombination proteins [BR:lcf03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     108884291 (parp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg WGR WWE KaiA
Motif
Other DBs
NCBI-GeneID: 108884291
NCBI-ProteinID: XP_018533642
LinkDB All DBs
Position
Unknown
AA seq 648 aa AA seqDB search
MRRTRGSRNKSQGAAENEEVQSKTVWQWKGDEGQWELYLPSACAVLDSAVSSGKTTVTLT
LGSGTAYEVDLKKMVQINPVTKYKRKIRSQTVKSESLDEAGDSTASSKVQVKEEEEETEE
PPVAKRRRGQSKSQTKTEDMPKEEIKSEEVVKTVVMKGKAPVDTECKAKLGKAHVYNEGN
DVYDVMLNQTNLQFNNNKYYLIQLLEDDSSKAYSVWMRWGRVGKVGQNSLTACGGDLLKA
KNIFKKKFLDKTKNEWEQRTSFEKVAGKYDMVLMDYSSNEKDENQTTEDAVPKKKTSMLD
VKIQSLLELICDLKAMEECVLEMKFDTRKAPLGKLTSEQISAGYTALKRIEECLKKKGSS
RELLEACNQFYTRIPHDFGLKTPPIIRTEDELKEKIALLEALSDIQIAVKMVQSSEGSDE
HPLDRQYRSLQCNLQPLDSGSQEYKVIEKYLQSTHAPTHCDYSMTIVDIFSVDRDGESNN
FLSQLHNRTLLWHGSRLSNWVGILSKGLRVAPPEAPVTGYMFGKGIYFADMSSKSANYCF
ANQHNHVGLLLLCEVALGDCNELLDADYEANKLPAGKHSTKGLGQTGPDPKNSVTLDGVT
VPMGPGVKTGVGKNSGYSLLYNEFIVYNPAQTRMRYLLRIKFNYSSLW
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgaacaagagggtcgaggaataaaagtcagggtgcagccgaaaacgaagaggtc
cagtcaaaaacagtgtggcagtggaagggagatgaaggacagtgggaactgtacttgccc
tcagcctgtgctgtgttggactccgctgtctcctcaggaaaaaccaccgtcactctaact
ctgggctctgggacggcctatgaagtcgacctgaagaagatggtccagattaatcctgtc
acgaaatacaagaggaagattcgctctcagacagtaaagtcagagagtttggatgaagct
ggtgactcgactgcctcttctaaagttcaagttaaagaggaagaggaggagacggaggag
ccacctgtagctaagagaaggagagggcaaagcaagagtcagacaaaaactgaggacatg
cccaaagaagaaataaaaagtgaagaggttgtgaagacggtggtcatgaagggcaaagct
ccagtggacactgaatgtaaagccaaactgggaaaggctcatgtttacaatgaagggaat
gatgtttacgatgtgatgttgaaccagacaaatcttcagtttaacaacaacaaatactac
ctgatccagctgctggaagatgacagctccaaagcttacagtgtgtggatgagatggggc
agagtgggcaaagtgggtcaaaacagccttacagcctgtggtggagatctgctgaaagcc
aaaaatatcttcaagaaaaagttcttagacaagaccaagaacgagtgggaacagcgcacg
agttttgagaaagtagctggaaaatatgacatggtgttaatggactacagctcaaatgaa
aaggatgagaaccagactacagaggacgctgtacccaaaaagaagacctccatgctggat
gtgaagatccagtctctcctagagctcatctgtgaccttaaagccatggaggagtgtgtg
ctggagatgaagtttgacacccgcaaagctcctcttggcaaactaacctcagagcagatc
agtgcaggctacactgcactaaagaggattgaggagtgtttgaagaagaaaggcagcagt
cgtgagctgctggaggcatgcaaccagttctacacccgtatcccccatgactttgggttg
aaaactcccccaatcatccgcacagaggatgagctgaaggagaaaattgcactgctggag
gcattgagtgacatccagatagcagtgaaaatggtccagtccagtgaaggaagtgatgaa
catcctctggacagacaataccgctccctccagtgcaacctgcagcctctggactccggc
agtcaagagtacaaggtgatagaaaagtatctgcagtccactcacgctccaacccattgt
gactactctatgaccatcgttgacatcttctcagtggacagagacggggagagcaacaac
ttcctctcacagttacacaacaggactctgctgtggcatggttcccgtctgtctaactgg
gtcggcatcctcagtaaggggctcagagtggccccacctgaagctcccgtcactggctac
atgtttggtaaaggtatctactttgctgacatgtcttcaaagagcgccaactactgtttt
gccaatcagcacaatcatgttggactgctgctactgtgtgaggtcgctctgggagactgt
aatgagctgctagatgccgactacgaggccaacaagctgcctgctggtaaacacagtacc
aagggccttggacagaccggacctgaccccaaaaactctgtcacactggatggtgtcaca
gtgccaatggggcctggggtgaagacaggggtgggtaaaaacagcggttactccctcctc
tacaacgagttcatcgtttacaaccctgcccagacccgcatgaggtacctgctgcggatc
aagttcaactactcttcactgtggtga

DBGET integrated database retrieval system