KEGG   Lates calcarifer (barramundi perch): 108884378Help
Entry
108884378         CDS       T04895                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase E-like
  KO
K05622  transglutaminase 5 [EC:2.3.2.13]
Organism
lcf  Lates calcarifer (barramundi perch)
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    108884378
Enzymes [BR:lcf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     108884378
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 108884378
NCBI-ProteinID: XP_018533749
LinkDB All DBs
Position
Unknown
AA seq 706 aa AA seqDB search
MAAAVKQSILKEVDLHIKTNKTEHHTSEVLEEQLIVRRGQPFTLTLKLTQPFNPDLHPLT
IIAVTGENPSENLGTKSCFGIPDSVKRSPSAKAVWKVELHKNSSSLTGVLILTITPPAVS
PIGEYELSVKHREEETSLATLVVLFNPWCPDDSVFLPDEKERQEYVMNEHGTIYKGSGNY
ISSMSWDFGQFEENMVKICLTLLDMNHKHFKEPAKDVSARCDPIYVSRVISAMINSEDDR
GVLEGRWTGPFYGGVAPSHWNGSHAILKHWYNIGCHPVKYGQCWVFAGVMCSVMRLLGIP
CRVITNYQSAHDNNRNLIIDVYHADYGVRAKESKDSVWNFHVWVEGWMRRPDLTKDGTYD
GWQVLDPTPQEMSDGVFCCGPASVKAILNGDTHLKYDVPFVFAEVNADCVDWLVKADGSK
VKIFSDTKRIGQNISTKYIGSNKRWNITDNYKHREGSETEREIFKQAITRDFSRGEKDSE
NGETEEKLPPPEVFMRFEEVSKPMDGKDVSLRLVLHSESSVARPLSINISVQAMKYNGSP
AANIQTEVKEETLEPGKELSIPVLVPFSVYHKHMVESDNIKVSAVVTDKEKPENTYLAVD
NVVLQDPPISLTVPSEVKLYREASGEVVFTNLVDKTLTDCTLTLSGSGLFREEFEVKLPD
LPPNRRLRIKFPFFPHKAGKKTLIIDFDCSTFRDIKASHTVNVTED
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggcggttaaacaatctatcctaaaggaagtggacctccacattaagaccaac
aaaactgaacaccacaccagtgaagtcttagaggaacagctgatcgtgagacgaggccag
cccttcactctgacccttaaactgactcaacctttcaaccccgacctccacccactcacc
atcatcgcagtgacgggtgaaaatccatctgagaacctggggacaaagtcatgcttcggt
atcccagacagcgtgaagcgttcaccatcggcaaaggcagtatggaaggttgagcttcac
aagaactcctcctcactaacaggcgtcttgattttgaccattaccccccctgctgtcagc
cccataggagagtacgagctgtctgtgaaacacagggaagaggagacatcactggcaacg
ctggtggtgctcttcaacccctggtgtcctgatgactccgtgtttctgcctgatgagaag
gaaagacaggagtatgtgatgaatgaacatggaaccatctacaaaggaagtggaaactac
atcagctctatgtcctgggacttcggacagtttgaagagaacatggtgaagatttgtctg
acgttattggacatgaaccacaaacacttcaaagaaccagctaaggatgtttctgctcgc
tgtgaccccatctatgtcagccgcgtgattagcgccatgatcaacagtgaagatgaccgt
ggtgtcctggagggacgctggacaggtccattttatggcggggtcgcaccctctcactgg
aacggcagccatgccatcctaaagcactggtataatattggctgccacccagtcaagtac
gggcagtgctgggtgttcgctggcgtgatgtgctcagtgatgcgtctgctgggcatcccc
tgccgcgtgatcaccaactaccagtcagcccacgacaacaacaggaatctaatcatcgat
gtgtaccatgccgactatggtgtcagagcaaaagaatccaaggacagtgtttggaacttc
catgtgtgggtggaggggtggatgagacgtccagacctgacaaaagatggtacatatgat
ggctggcaagttctggatccaacaccacaggagatgagcgatggtgttttctgctgtggt
ccagcttcagttaaagccatcctgaacggagacacccatctcaaatacgacgtcccattt
gtcttcgctgaggtcaatgctgactgtgttgactggctggtcaaagctgacggttcaaaa
gtgaaaattttctctgacaccaagagaatcggtcagaatatctcaactaaatatatcggc
tccaacaagaggtggaacatcaccgataactacaaacacagagagggatcagagacagag
agggagatctttaaacaagccatcaccagagacttctccagaggtgaaaaggacagtgag
aatggggaaacagaggagaagcttccaccgccagaagtgttcatgcgatttgaagaggtg
tccaagccaatggacggtaaggatgtgagcctgaggttggtgctgcacagtgagagcagt
gtcgccaggccgctgtccatcaacatcagtgtccaggccatgaagtacaacggctcacca
gctgcaaacatccagactgaggtgaaggaggagacactggagcctgggaaagagctgtcc
atccctgtcctggtcccattctcggtctaccataaacacatggtggagagtgacaacatc
aaggtttcagctgtggtcacagacaaagagaagccagaaaacacatacctggctgtggac
aacgttgtgctgcaggaccctcccatctccctcaccgttcccagtgaggtcaaactgtac
cgtgaggcgagtggggaggtggttttcacaaacctggttgacaagacgctgacagactgc
actctgactctctctggaagtggcctgtttagagaggagtttgaagtcaaacttccagat
ctgccaccaaaccgccggctacgcatcaagtttcccttttttcctcacaaggccggaaag
aagactctcataatcgactttgactgctccaccttcagagacatcaaggccagccacact
gtcaacgtcacagaagactga

DBGET integrated database retrieval system