KEGG   Lates calcarifer (barramundi perch): 108886103Help
Entry
108886103         CDS       T04895                                 

Gene name
aldh2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00010  Glycolysis / Gluconeogenesis
lcf00053  Ascorbate and aldarate metabolism
lcf00071  Fatty acid degradation
lcf00280  Valine, leucine and isoleucine degradation
lcf00310  Lysine degradation
lcf00330  Arginine and proline metabolism
lcf00340  Histidine metabolism
lcf00380  Tryptophan metabolism
lcf00410  beta-Alanine metabolism
lcf00561  Glycerolipid metabolism
lcf00620  Pyruvate metabolism
lcf01100  Metabolic pathways
Module
lcf_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108886103 (aldh2)
   00053 Ascorbate and aldarate metabolism
    108886103 (aldh2)
   00620 Pyruvate metabolism
    108886103 (aldh2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    108886103 (aldh2)
   00561 Glycerolipid metabolism
    108886103 (aldh2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    108886103 (aldh2)
   00310 Lysine degradation
    108886103 (aldh2)
   00330 Arginine and proline metabolism
    108886103 (aldh2)
   00340 Histidine metabolism
    108886103 (aldh2)
   00380 Tryptophan metabolism
    108886103 (aldh2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    108886103 (aldh2)
Enzymes [BR:lcf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     108886103 (aldh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 108886103
NCBI-ProteinID: XP_018536267
LinkDB All DBs
Position
Unknown
AA seq 518 aa AA seqDB search
MLRTVFSRALPGLSRLSVCHYSAAAIPAPNIQPEVHYNKLFINNQWQDAVSGKTFPTINP
ATGEVICQVAEADEADVDKAVKAAHNAFRLGSPWRRMDASHRGLLLNRLADAIERDSTYL
AELETLDNGKPYAVAYTVDLPNVVKCLRYYAGWADKWEGKTIPIDGDYFCYTRHEPIGVC
GQIIPWNFPLLMQAWKLGPALATGNTVVMKVAEQTPLTALYVASLIKEVGFPEGVVNILP
GMGPSAGAAIAKHMDVDKVAFTGSTEVGHLIQQASGSSNLKKVTLELGGKSPNIILSDAN
MEDAVEQSHFALFFNQGQCCCAGSRTYVQADIYDEFVERSVERAKRRVVGNPFDLKTEQG
PQVDQEQFNKILGYISSGKREGAKLMCGGGVAADRGYFIQPTVFGDVQDNMTIAREEIFG
PVMQILKFKSLEEVVTRANDTKYGLAAAVFTKDIDKANYVSNGLRAGTVWINCYDVFGAQ
APFGGYKASGNGRELGEYGLDNYTEVKTVTIKVPQKNS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgctccgtactgtgttttctcgggcccttcccggactgagccggctgtcggtgtgtcac
tactctgctgccgccatcccagcccccaacatccagcccgaagtccactacaacaagctg
tttatcaacaaccagtggcaggacgcagtgagtgggaaaactttccccaccatcaaccca
gcaaccggtgaagttatctgtcaagttgcagaggctgatgaggcagatgtagacaaggca
gtgaaagcagcacataatgccttcaggctggggtcaccatggcgacggatggacgcctct
catcgcggcctgctgctcaaccgactggctgatgcgattgagagagactctacctatctt
gccgagctggagactcttgacaatgggaagccatatgctgtcgcctacactgttgatctg
cccaatgtggtgaagtgtctcaggtactacgcaggctgggctgacaaatgggagggaaag
accatccccattgatggagattatttctgctacaccaggcatgagcccattggagtctgt
ggacagatcataccgtggaacttccctctgttgatgcaggcgtggaaactcggccctgcc
cttgcgactggtaacactgtggtgatgaaagttgcagagcagactccactcacagctctc
tatgtagccagcttgattaaagaggtgggtttccctgaaggtgttgtgaacatcctgcca
ggcatgggcccatcggctggtgctgccatcgcaaagcacatggatgttgacaaggtggcc
ttcactggatccacagaggtgggtcatctgatccagcaggcttcaggcagcagtaacctg
aagaaagtcaccctggagctgggaggaaagagccctaatatcatcctgtctgatgccaac
atggaggatgcagtggagcagtcccactttgctctgtttttcaaccaaggccagtgttgc
tgcgctggctctcgaacctacgtccaggcagacatctacgatgagtttgtggagcgcagt
gttgagcgagctaagagacgagtggtgggaaacccttttgacttaaagactgaacaggga
cctcaggtcgatcaggagcagttcaacaagattctgggttacatcagcagtgggaagaga
gaaggagccaagctcatgtgtggaggaggagtggccgcagacagaggatacttcatccag
cctactgtgtttggagatgtccaggacaacatgaccattgccagggaggagatctttggt
ccagtgatgcagatcctgaagtttaaatcactggaggaggtggtgacgagagcaaacgat
actaagtatggtctggcagccgctgtgtttactaaggacattgataaagccaactatgtc
tccaatgggctccgtgctggcacagtctggattaactgttatgacgtgtttggggctcag
gctccgtttggtggttacaaggcttcaggtaatggcagagagctgggagagtacggtctg
gacaactatacagaagtcaaaacggtgaccatcaaggtaccacagaagaattcatag

DBGET integrated database retrieval system