KEGG   Lates calcarifer (barramundi perch): 108886343Help
Entry
108886343         CDS       T04895                                 

Gene name
si
Definition
(RefSeq) sucrase-isomaltase, intestinal
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00052  Galactose metabolism
lcf00500  Starch and sucrose metabolism
lcf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    108886343 (si)
   00500 Starch and sucrose metabolism
    108886343 (si)
Enzymes [BR:lcf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     108886343 (si)
    3.2.1.20  alpha-glucosidase
     108886343 (si)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 108886343
NCBI-ProteinID: XP_018536675
LinkDB All DBs
Position
Unknown
AA seq 1825 aa AA seqDB search
MGKRRFSGLEVALMVLFTLMSVAALTFIVLFVTGEPGVIKDETTDPFVPQCPRIPLAERV
DCFPDAGASKLKCEQRGCCWGPLDERNVPWCFFPTNHGYTVESVEQPNPYVMKAQLKRMA
SPSLFGADIQDLSFHAEMQTNNRLRFKIYDAHRQRFEVPHEHISSLNSDPSSPISNTLEI
TQKPFGLTVHRGGNKKVLFDTTMAPLVFEDQYLQLSAKLPSHNIYGLGEHVHRHYRHDTN
WRTWPIFTRDAFPNGGTHNLYGHYPFFLCLEDESGKSFGVFLMNSNAMEVTLQPAPAVTY
RTIGGVLDFYILFGDTPEQVVQEFLELIGRPVIPPYWSLGFQLSRWDYGSLSEVKKTVER
NRAVGLPYDIQYTDIDYMEDKKDFTYDKVKFSELPQFADYLHEKGQRYILILDPAIATSK
RVGNNTYDSYDRGNEKNAWVTEADGKTPLLGEVWPGETVFPDYTSQNCIDWWVDEYERFS
REIKHDALWIDMNEVANFKKGSTKGCADNNLNYPPYTPKILDEVMYSKTLCMDAKQAWGN
HYDVHSLYGYSMVLATEKALQRVFGGNRTLMLTRSSFPGVGKYSGHWLGDNAANWNDIKW
AIPGMLEFGLFGIPYIGADICGFFDNSSEELCRRWMQVGAFYPFSRNHNAQGYKPQDPAA
YGADSTLVESSKHYLRIRYTLLPYLYTLFYKAHTTGETVVRPVMNEFYSDSATWTVDRQF
LWGKHLLITPVLDPGVDRVRAYVPDAVWYDYETMLRLGNRKTYVDMFLPADKLGLHIRGG
AVLPTQRPDVTTTYSRRNPMGLIVALDDNNQAAGELFWDDGDSRDTVKSGNHIHYTFSAV
YGVLTMQVTHAGYKDPNNLKFENIIVLGVPSPPMSVSVTHVRNGAQGNSTTVLPNTNIQY
DGAKEVLFLSGLSLTLGETYLVQWELVKEEYQRFDCYPEEHADEAKCKARGCIWEPSNIE
RVPWCFYPKDYGYTVTGKQETNSGMRIDITRNKKHRSIGRPGSPDIDTLRVEVRYHSGDM
LQFKIWDPATYRYEVPVPLTVPAVPETDENKRLYKVLIENNPFGIKVIRKSTGTKIWDSS
VPGFTFSDMFIQVSTLLSSEFVYGFGETEHPTYKHNLNYHTWGMFSKDQPPGYKMNCYGV
HPFYMGLETTTDAHGVLLLNSNAMDVTFQPTPALTYRTLGGILDFYMVLGPTPEMVVQEY
TALIGRPVLPAYWSLGFQLCRYGYANDTEIEDLYRDMKAAGIPYDVQYADIDYMERQLDF
VLDSQFKNLPALVDRMRGEGMRFIFILDPAISGNETVYYPAFERGKAADVFIKWPENISN
EIVWGKVWPDFPNITVDESLDWDTQVELYRSYTAFPDFFRNTTAMWWHREIQDFYTDTMK
FDGLWIDMNEPASFVHGTVGGKCLGNPLLENPPYMPPLESKHLGLNHKTLCMNSEQILSD
GKKVRHYDVHNLYGWSHTKPTYDALLNVTGKRGIVVTRSTYPSSGKWAGHWLGDNNASWD
QLYKSIIGMMEFSLFGIPYTGADICGFFNKAEYEMCLRWMQLGAFYPYSRNHNGKGNPRQ
DPVAWNAAFAEASRDVLNIRYTLLPYLYTLMFEAHTKGSTVVRPLLHEFVNDKTTWDIYR
QFLWGPALLITPALDKGVRTVNGYVPNARWYDFHTARDVGVRGQMVNMPTPIDHINLHIR
GGYVIPWQKPENNTYYSRMNPLGLIVALSDSGTAQGSFFWDDGEGINTVERGKYLWTSFA
AQSNTLTSQVVHNELAPADRLTLGVVKVWGAGSVRITTAILTDESGTAHTLTPQHNLNTQ
ELIIDATAKSVRADQRFTLTWRTSI
NT seq 5478 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaaggcggttctcaggtttggaggtggccctaatggtcctgttcacattgatg
tctgtggcagctctaacattcatagttctgtttgtcaccggagaacctggggtcattaaa
gatgaaactacagacccatttgttcctcagtgtcccagaattcccctggctgaaagggtt
gactgtttccctgatgctggagcttcaaagctaaaatgtgaacaacgtggatgttgctgg
gggccactggatgagagaaatgttccctggtgcttcttcccaaccaaccatggatacaca
gtggaatcggtagaacagccaaatccttatgtgatgaaagcccagctgaagagaatggcc
tctccttcattatttggggctgacatacaagatctgtcatttcacgcagaaatgcagaca
aacaatcgactccgttttaagatctacgatgcccacaggcagagattcgaggtcccccat
gagcacatcagtagcctcaacagtgacccatccagccccatcagcaacacactggagatc
acacagaaaccctttggccttactgtgcacaggggggggaacaaaaaagtcctgtttgac
actacaatggccccactggtgtttgaagatcagtacctacagctgtctgctaagcttcca
tctcataatatttatggtctgggagagcatgtgcacagacactatcgccatgatacaaac
tggagaacttggcccatcttcacaagagacgctttccctaatgggggaacacataacctc
tatggacactatcctttcttcctctgtctagaggatgagagcgggaagtcatttggggtc
ttcctcatgaacagcaatgctatggaggtgactctccagcctgctccagctgtgacctac
aggacaataggaggggtccttgacttctacattctctttggagatacaccagaacaagtg
gtgcaggagttccttgagctcattggtaggcctgtcattcctccctactggtccctgggt
ttccagctttctcggtgggactacggtagcctaagtgaggtcaagaaaacagtggagagg
aaccgtgctgtgggccttccatatgacattcagtacactgacatagattacatggaggat
aagaaggatttcacctacgacaaagtcaagttcagtgagctgcctcagtttgcggactac
ctccatgagaagggtcaaagatacatcctcattctggatcctgcaatagctactagtaag
agagtagggaacaatacatatgactcctacgaccgtgggaatgagaagaatgcctgggtc
actgaagcagatgggaaaacacctttgttaggagaggtgtggccaggagagacagtgttt
ccagactacaccagccaaaactgcatcgactggtgggttgatgagtatgagcgattctcc
agagagatcaaacacgatgccctttggattgacatgaatgaggttgctaatttcaagaaa
ggatcaactaagggctgtgccgataacaacctcaactaccctccttacactccaaagatt
ctggatgaggtgatgtacagtaagactctgtgtatggatgccaagcaggcctgggggaac
cactatgatgtccacagtctgtatggctactctatggtgctggctactgaaaaagctctg
cagcgtgtgtttggaggaaaccgtaccctgatgttgacccgctcctccttcccaggtgtg
ggaaaatattcgggtcactggctgggggacaatgctgccaactggaacgacattaaatgg
gccatccctggcatgttagagtttggactctttgggattccctatattggagctgacatc
tgtggattctttgacaactcctctgaagagctgtgtcgtcgctggatgcaggtgggagct
ttctaccccttcagtcggaaccacaacgctcagggctacaagccccaggatccagctgca
tatggtgctgattcaacgctagtggagagctctaaacactacctgcggatacgttacaca
cttttgccttacctctacacactcttctacaaagcccacaccacgggggagactgttgta
cggcctgtcatgaacgagttctactctgacagtgccacctggacagtggaccgccagttc
ctctgggggaaacacctgctcatcacacctgtactggacccgggtgtggacagggtgcgg
gcatatgtgccagatgctgtgtggtatgactatgagacgatgttacgactgggaaaccgc
aaaacgtatgttgatatgtttctaccagctgacaagcttggtttacacatcagaggtggt
gcagtcctccctacacagagacctgatgtcaccactacgtacagtcggcgtaaccccatg
ggcttgatcgttgctcttgatgacaacaaccaggcagctggggagctattctgggatgat
ggagattcccgagacacagttaaaagtggcaaccacatccactacacattctctgcagtc
tacggagtgctgacaatgcaggtgacccatgcgggttacaaggacccaaacaaccttaaa
tttgagaacataattgtgctcggggtgccttctcctcctatgtctgtctctgtgactcat
gttcgcaacggagcacaaggaaactctaccacagtgttgccaaacaccaacatacagtat
gatggagccaaggaggttctgttccttagtggcctctccctgaccctgggggagacctac
ctggtacagtgggaactggttaaagaagagtaccagcgctttgactgctatccagaggag
catgcagatgaggctaagtgcaaggccagaggctgcatctgggagccaagcaacattgaa
cgtgttccatggtgcttctatccgaaagactatggatatactgttacaggaaaacaggaa
actaactcaggcatgagaattgatatcactcggaataagaagcacaggagcattggtcgc
cctgggtcacctgacattgacacacttcgtgttgaggtccgttaccacagcggtgacatg
ctgcagttcaagatctgggaccccgccacatatcgttatgaggttccagtgccgctgacg
gttcctgctgttccagagactgacgagaacaagaggctttacaaggtccttattgaaaac
aacccattcggcatcaaggtcataaggaaaagcacaggaaccaagatttgggactcatct
gtgccaggttttaccttctcagacatgttcatccaagtgtctactctactgtcttcagag
tttgtctacggctttggagagacagagcatcccacctataagcacaacctcaactatcac
acctggggtatgttctccaaggaccagcctcctggttacaagatgaattgctatggagtg
catcccttctatatgggcctggagaccaccaccgatgctcatggtgtgctactgctaaac
agcaatgccatggatgtgactttccagcctactccagctttaacctaccgaactctggga
ggcattctggatttttacatggtcctgggacctacgcctgagatggtggtgcaggagtac
actgcactgattggacgacctgttctacctgcctattggtctcttgggtttcagctctgt
cgctatggttacgccaacgacacagagatagaagacctatatagagatatgaaggcagcg
ggtataccctatgatgtgcagtatgcagatattgactacatggagcgtcagctggacttt
gtcctggactcacagtttaaaaacctgcctgccctggttgaccgcatgagaggagaaggc
atgaggttcatcttcattctggatccagccatctcaggcaatgagacagtttattaccct
gcctttgaaagaggaaaagctgcggatgtcttcatcaaatggcccgaaaacatcagtaat
gaaattgtgtgggggaaggtctggccagatttccctaacatcacagtagatgaatctctg
gactgggatacacaagtagagctttacaggtcttatacggcattccctgactttttccgt
aatacaacagctatgtggtggcatcgagaaatccaggatttctatacagataccatgaag
tttgatggcctctggattgacatgaatgaacctgccagttttgtccacggcacagttggg
gggaagtgtcttggtaatccacttctagagaaccctccgtatatgccacccttggagtcc
aaacatcttggcttaaaccataagactctgtgcatgaacagtgagcagatactcagtgat
ggaaagaaagtcagacactatgacgtccataacctctatggctggtctcacaccaagccc
acctatgatgccctgctgaatgtgacaggtaaaagaggcatagtggtgacgaggtccact
tacccctccagtggaaaatgggctggacattggctgggagacaacaatgccagctgggac
cagctttacaaatccattataggcatgatggagttcagtctgtttggcatcccttacacg
ggggcagacatatgcgggttctttaataaagctgagtatgaaatgtgtcttcggtggatg
caactgggtgccttctatccatactcacgcaaccacaacggcaagggaaacccgagacaa
gaccctgttgcttggaatgctgcctttgccgaggcgtcccgggatgtcctgaacatccgt
tacacccttctgccctacctgtacacactcatgtttgaggctcataccaaaggaagtaca
gtagtcagacccctcctgcatgagtttgtgaatgataaaactacatgggacatctacagg
cagttcctctggggacctgctctacttatcactcctgccctcgacaagggagtcaggact
gtgaatggctacgttcctaatgcacgctggtatgacttccacacggccagagatgttgga
gtacgcggccagatggttaacatgccgacacccatagatcatattaaccttcatatcaga
ggaggatatgtcataccctggcagaaaccagagaacaatacatattacagtcggatgaat
cctttaggactgatcgttgccctaagcgacagtggaactgctcaaggatcgttcttctgg
gatgatggggaaggaataaacacggttgagcgaggaaaatatctgtggacctcgtttgca
gcgcaatcgaacactttgaccagtcaggttgtccacaatgaactggcccctgctgaccgc
ttgaccctgggtgtggtgaaggtttggggcgcaggcagtgttaggatcacaacagcgatc
ttaacagatgagagtggaacggcgcatacactcaccccgcagcacaaccttaacactcag
gagctgattatagatgctactgcaaagtctgtccgggcggatcagcgttttaccttaaca
tggaggaccagcatctga

DBGET integrated database retrieval system