KEGG   Lates calcarifer (barramundi perch): 108886473
Entry
108886473         CDS       T04895                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: cyclin-dependent kinase inhibitor 1-like
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04012  ErbB signaling pathway
lcf04068  FoxO signaling pathway
lcf04110  Cell cycle
lcf04115  p53 signaling pathway
lcf04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108886473
   04068 FoxO signaling pathway
    108886473
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108886473
   04115 p53 signaling pathway
    108886473
   04218 Cellular senescence
    108886473
SSDB
Motif
Pfam: CDI Prd1-P2
Other DBs
NCBI-GeneID: 108886473
NCBI-ProteinID: XP_018536873
LinkDB
Position
Unknown
AA seq 186 aa
MQLSQLTVGLSLRSLQCKTMATHKQILSALGNGPARRNLFGPVDREQLQVEYQVALRKDL
EEASRRWGFDFILDKPLESSDFQWEGIPGTKVPLLYRSCMLGLGNTEGQRLAEVTVISKG
GRAEPQQSEKENIPRTPERHGELNLKDLEKTPEKRENTGLKRKQTNITDFYQAKRRVVGM
PRKSGE
NT seq 561 nt   +upstreamnt  +downstreamnt
atgcagctttcccagctcaccgttggtctttctctccgttccctgcagtgtaaaacgatg
gctacacacaagcaaatcctgagtgccctggggaacggcccagcccggcgaaacctcttc
ggccctgtggaccgagagcagctacaggtggagtatcaggtggccctgcggaaagacctg
gaggaggcctcgcggcgctggggctttgacttcatcttggacaagcctctggagagcagc
gatttccagtgggagggcatcccaggcaccaaggtgccgctgctctaccgatcctgcatg
cttggtctgggaaacacagaaggtcaaaggttggcagaggtgacggtaatctccaaggga
ggacgggcggagccacagcagagcgagaaggagaacatcccgcgtacaccagagagacat
ggtgagctcaacctgaaggacctggagaaaacaccagagaaaagagagaacacagggctg
aagaggaaacaaacaaacatcacagatttctaccaggctaaaagaagagtggttgggatg
ccgcgcaaatccggcgagtga

DBGET integrated database retrieval system