KEGG   Lates calcarifer (barramundi perch): 108887082Help
Entry
108887082         CDS       T04895                                 

Definition
(RefSeq) histone deacetylase 4-like isoform X1
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108887082
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lcf03036]
    108887082
Enzymes [BR:lcf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     108887082
Chromosome and associated proteins [BR:lcf03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     108887082
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 108887082
NCBI-ProteinID: XP_018537773
LinkDB All DBs
Position
Unknown
AA seq 1105 aa AA seqDB search
MSSHSRQGGLSSKEQPLELLKPAALNHFVDVSTAALPTQVPPTTTAILPMDLRVVDHHHH
HQQPPFGLVPQTHPIPPTSTACPVSTEPGRGPVISHREQQLQQELVALKHKQQLQRQLLI
AEFQRQHEQLSRQHEAQLQEHIKHQQDLLALKHQQELLEHQRKMEQQRHEQQLEKQQREH
KLQQLKNKERGQESAVASTEVKMRLQEFVLNKKKALAQRSLNHCLPSDPRYWYGKTQHSS
LDQSSPPQTALSAYNHPMLGTYDSKDDFPLRKTASEPNLKLRSRLKQKVTERRSSPLLRR
KDGPITTAKKRSLDVAESACNSAPGSGPSSPNNSSSNIPNENGVTISSSPGEASLLQRLA
AREGSVSQLSLYTSPSLPNITLGLPATGPANTVVSGHQDVESHLPALQQGIPLTPPFLPT
AHLPSYLDREGAGGGTAGHNPLLQHMVLLEQSHNPMVGLGALPLPSPSVSKLARGHRPLG
RTQSAPLPQQQCGQAQALQQLVVQQQHQQFLEKHKQLFQHQQQHIINKIMSKPSDQVSAA
GSGASGPARQHQSHPEETEEELREHQGLSSSSSSSSTTSVPETGPLRGLVIKQEPPDLQE
QEEREQRERQAEQDFLFRQQALLLEQQRIHQLRNYQASMEAAGLSVSLAGHRPLSRAQSS
PASASFPMVVQEPPAKPRFTTGLVYDSLMQKHQCMCGNSTSHPEHAGRIQSIWSRLQETG
LRVHCECIRGRKASLEELQTVHSEAHVLLYGTNPLRQKLDCSVSPMFVRLPCGGIGVDSD
TIWNEVHSSSAARLAVGSVVELVFKVASGELKNGFAVVRPPGHHAEESTPMGFCYFNSVA
IAAKLLQQRLNVSKILIVDWDVHHGNGTQQAFYADPSVLYLSLHRYDDGNFFPGSGAPDE
VGSGAGVGFNVNMAFTGGLEPPMGDAEYLAAFRTVVMPIANEFAPDVVLVSSGFDAVDGH
APPLGGYKLTAKCLGYLTRQLMGLAGGRLVLALEGGHDLTAICDASEACVSALLGNELDP
IPDEVLQQRPNANAVHSMEKVTETHSKYWRSLQRSASTLGCSLSEALQREAEEAETVSAM
ASLSVANKHIGKRSEEEPMEEEGPM
NT seq 3318 nt NT seq  +upstreamnt  +downstreamnt
atgagctctcacagccgacaaggtggcctgagcagcaaggagcagcctctggaactcctc
aaaccagctgcactcaaccatttcgtggacgtgagcacggcagcgctgcccacgcaggtg
ccccccaccaccacagccatcctccccatggacctgcgcgtagtggaccaccaccaccac
caccagcagcccccctttggcctggttccccaaacccaccccataccgcccacctccaca
gcttgtcccgtgtccaccgagccgggccgcgggccggtcatcagccaccgggagcagcag
ctacagcaggagctggtggcgctcaagcacaagcagcaactccaaagacagctgctgatc
gcagagttccagaggcagcatgagcagctgtcgagacaacatgaagcccaactgcaggag
cacatcaagcaccaacaggatttactggcactcaaacaccaacaggagctgctggagcat
cagaggaagatggagcagcaacgtcacgagcagcagctggagaagcagcagcgggaacac
aaactccaacagctcaaaaacaaggagaggggacaagagagtgcagtcgccagtacagag
gtaaagatgcggcttcaggagtttgtcctgaacaagaagaaagccctggctcagcggagt
ctaaaccactgtctgcccagcgacccacgctactggtatggaaaaactcagcacagctct
ttggaccagagctctcctccacaaacagcactgtcagcgtacaaccacccaatgctgggc
acatacgactcaaaagacgacttccctctccgcaaaacagcctccgagcccaacctgaag
cttcgttccaggctaaagcagaaggtgaccgagcgccgcagcagccctctgctgcgcagg
aaggacggcccgatcactactgccaagaagcgttcactagacgtggctgagtctgcatgc
aacagtgcaccaggctcaggacccagctcccccaacaacagctccagtaacatccccaat
gagaacggagtcaccatctccagcagcccaggggaggcctccctgcttcagagattggct
gcaagggaaggttcagtgagccagctctctctgtacacctccccctctctgcccaacatc
accctgggactgccagccacaggccctgccaacactgtggtatcaggacaccaagacgtc
gagagtcatctgccggcgttacagcagggcattcctctgacccctcccttcctgcccact
gcccacctgccctcatacttggacagggagggggctggaggaggcacggctggtcacaac
ccactcctccaacacatggtactgctggagcagagccataatccaatggttggtctgggt
gctcttccgctgccatcgccctccgtctccaagctcgcgcggggccaccgtcccctgggc
agaacccagtcggcccctctgccccagcagcagtgtggacaggcccaggccctgcagcag
ctggtggtccagcagcagcaccagcagttcctggagaaacacaaacaactgttccaacat
cagcagcagcacatcatcaacaagataatgtccaagcccagcgatcaggtctcggctgca
ggctctggtgcttcagggccagccaggcagcaccagagtcacccagaggagacggaagag
gagctcagggagcatcaggggctgtcctcctcctcctcctcctcctccaccacctccgtg
ccagagacggggccgctacgggggctggtcatcaaacaggagcccccagacctccaggag
caggaagagagggagcagagggagagacaggccgaacaggacttcttgttcagacagcag
gctctgctgttagagcagcagcgtattcaccagttgaggaactaccaagcctccatggaa
gcagccgggttgtcagtcagcctcgctgggcaccgccccctgtccagggctcagtcgtct
ccagcctccgcctccttccccatggtggtgcaggagccgcccgccaagcctcgatttacc
acaggtctggtgtatgactctctgatgcagaagcaccagtgtatgtgtggtaactccacc
agtcacccggagcacgctggccgcatccagagcatctggtcccggctacaggagacaggc
ctcagggtgcactgtgagtgtatccgtggtaggaaggcctcgctggaggagttacaaaca
gtccactctgaagcccacgtcttgctgtacggaacgaacccactgcggcagaaactagac
tgctcagtgagtcccatgtttgtgaggttaccatgtggaggcattggggtggacagcgac
accatttggaacgaggtccattcatccagtgcagctcgcctggctgtcggctcagtggtg
gagctggtcttcaaagtggcatcaggagagctgaagaacggttttgctgtcgttcgacca
cctggacaccatgctgaggagagcacgcccatggggttctgttacttcaactcagtcgcc
atcgcagccaaactcctgcagcagaggctcaacgtcagtaaaatcctcattgtggactgg
gatgtccaccatggaaatggcacccagcaggccttctacgccgaccccagcgttctttac
ctgtcgctgcatcgctacgatgatggaaacttcttcccaggcagcggagcacctgacgag
gtgggcagtggagcaggtgtaggcttcaatgtgaacatggcctttactggaggactggaa
cctcccatgggtgatgcagagtatctagctgcattcaggaccgtggttatgcccattgcc
aatgagtttgccccagacgtggttctggtgtcttcaggcttcgatgcggtagatggacat
gctccacccctgggaggatacaaactgacagccaaatgccttggctacctgaccaggcag
ctgatgggtctggcaggcggacggttggtgcttgccctggaggggggtcacgacctcaca
gccatatgcgacgcctccgaagcctgcgtctctgctctgcttggcaatgagttggacccc
attcctgacgaggtgctgcagcagagaccaaatgccaacgctgtccactctatggagaaa
gttactgaaactcacagtaagtactggcgttcgctgcaacgctccgcctccacactcggc
tgctcgttgagcgaagccctccagcgtgaggcggaggaagcggagaccgtctctgctatg
gcctcgttgtctgttgccaacaagcacattggaaagaggtctgaagaggaaccaatggaa
gaggaaggtccaatgtaa

DBGET integrated database retrieval system