KEGG   Lates calcarifer (barramundi perch): 108887195
Entry
108887195         CDS       T04895                                 

Definition
(RefSeq) lysophosphatidic acid receptor 2-like
  KO
K04291  lysophosphatidic acid receptor 2
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04080  Neuroactive ligand-receptor interaction
lcf04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108887195
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108887195
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lcf04030]
    108887195
G protein-coupled receptors [BR:lcf04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    108887195
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 Ninjurin
Other DBs
NCBI-GeneID: 108887195
NCBI-ProteinID: XP_018537995
UniProt: A0A4W6GBD1
LinkDB
Position
Unknown
AA seq 388 aa
MDTVTEDKEGCYLNRSVKFFYEASGKNISDYWRKRDYVIVTLGMTVCFIVIFSNLLVIVA
ILKNKRFHFPIYYLLGNLALADLFSGVSYLHLMFHTGPWTIKLSKYQWFVRQGLIDTSLT
ASVLNLLAVAVERHQTIFNMQLHSKMSTRRVFIIMLFIWLVAIIMGLVPTMGWHCLCDLP
NCSTMAPLYSRSYLVFWAVLNLLTFSIMLAVYTRIFVYVRRKSKQMSQHTSQMRYKETVF
NLMKTVSMILGCFVICWTPGLVVLLLDGLGCEQCKVLLYEKYFLVLAECNSLVNPIIYSF
RDKDMRSTFKQILCCLCRRGSNHQGNSGVQFSTLEHEKSKYRSAVVKEKSNGVPLIGDGS
EDLPASSEKLNSNNDKLSAHEEDVLTHI
NT seq 1167 nt   +upstreamnt  +downstreamnt
atggatacggtgactgaggacaaagagggatgctacttaaaccgctctgtcaaatttttc
tacgaggcaagtggcaagaacatcagcgactactggcgcaaacgtgattacgtgatcgtc
acgctgggcatgacggtctgcttcatcgtcatcttttccaaccttctggtcatagtggcc
attttaaaaaacaaacggtttcactttcccatctactacctgttgggtaatctggctttg
gcagatctcttctcaggtgtctcctacctccacttgatgtttcacaccggtccctggacc
attaaactttctaagtaccagtggtttgtgcggcaggggctcatcgacaccagtctgaca
gcctcggtcctcaacctcctggccgtggcggtggagcgtcaccaaaccatcttcaacatg
cagctgcacagtaagatgagcacccggcgggttttcatcatcatgctgttcatctggctg
gtggcaataatcatgggcctggttcccaccatgggctggcactgcctttgtgacctgccg
aactgctccaccatggcgccgctgtacagccgcagttacctggtgttctgggccgtcctc
aatctgctgaccttctccatcatgttggccgtctacacccggatctttgtctacgtcagg
cgcaagagcaagcagatgtcgcagcacacctctcaaatgagatacaaagagacggtgttc
aacctgatgaagactgtctccatgatcctgggctgttttgtgatctgctggacgcccggc
ctcgtcgtgctcctgctcgacggtctgggctgtgaacagtgcaaggtgctgctctacgag
aagtacttcctggtgctggccgagtgcaactccctcgtcaaccccatcatctactccttc
agggacaaagacatgaggagcaccttcaagcagatcctgtgctgcctgtgccggcgtggc
agcaaccaccagggcaactctggagttcagtttagcaccctggagcacgagaagtctaag
tatcgttctgctgtggtgaaagagaagagcaatggggtgcctctcatcggcgatggctca
gaagacttacctgcctcttcagaaaaactgaactcaaacaacgataaactttcagcacac
gaggaagacgtgcttacacacatttga

DBGET integrated database retrieval system