KEGG   Lates calcarifer (barramundi perch): 108887309Help
Entry
108887309         CDS       T04895                                 

Definition
(RefSeq) epsin-1-like isoform X1
  KO
K12471  epsin
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108887309
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lcf04131]
    108887309
Membrane trafficking [BR:lcf04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    108887309
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ENTH ANTH UIM VHS
Motif
Other DBs
NCBI-GeneID: 108887309
NCBI-ProteinID: XP_018538176
LinkDB All DBs
Position
Unknown
AA seq 648 aa AA seqDB search
MSTSSLRRQVKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMV
WKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVAQQCRENIYAVQTLKDFQYIDRDGKDQG
VNVREKAKQLVTLLKDEERLREERIHALKTKEKMAQTSSASSAPSAPSLGGSLSLGSHSG
GGDPEQAWPQSSGEEDLQLQLALAMSKEEAEQTSADPLEDAELRYAITLSKEMHQKEERL
RRGDDLRLQMAIEESKREKPKSEESALMELSAADPWGAPAAATAGSAGPSPPPTVPAPAA
SGPWGAAPSDPWGVASPTSPTSSDPWGGGAPPTIAPPPDPWGETSNRVNNVDPWGSSAVT
PPSADPWGPPVPPSTSSSGGPVDPWARDGPVPASDPITSDIWSGTAKHTNGTGDPERRGS
SATGCDSTGSPVPFDLSSLGSSLPVRKTPESFLGPNAALVDLDSLVSSKPKPKQPPPPSI
SSSSAHNPFLQNTGSSPAPGMAVTPGSTISSRGVSPTPASSNPFGVAPPMTSISPQPSSL
GLSGLRTSPVPPNPMLGMVQPGMGMGPMSVGMGAPGMGLGMMQASPMGMPYSGLSPMAPP
GSALLGPGGTAPPQLILGGPAGTGGVMGAGGSVGGGGTTGASTNPFLL
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacctcatcgctacggcgacaagtaaagaacatcgtccacaactattcagaggct
gaaatcaaggttagagaagcaacatccaatgacccatggggccccagcagctctctgatg
tcagagattgctgatctgacctacaatgttgtggccttctcggaaatcatgagcatggtg
tggaagcgcctcaatgaccacggcaagaactggagacatgtatacaaggctatgactctt
atggagtacctgatcaagactggttcagaacgtgttgcccaacagtgccgagagaacata
tatgcagtccagaccctcaaggatttccagtacatagacagggacggcaaagaccagggg
gtcaatgtgcgagagaaagccaaacagctggtgacactgctgaaagatgaggagagacta
agagaggagaggatccacgccctcaaaaccaaagagaagatggcacagacctccagtgcc
tcctcagctccctcagcacccagcctggggggcagcctgtcgttgggctcccactctgga
gggggagatcctgagcaagcctggccacagagctctggagaggaagacctgcagctccag
ctggccttggcgatgagtaaagaagaggcagagcagactagcgctgaccctctggaggac
gcagagctccgctatgcaatcacactcagcaaagagatgcaccaaaaggaggagcgactg
cgaagaggtgatgacctgagactgcagatggccattgaggagagcaagagggagaaaccg
aagtcagaggagagtgctctgatggagctgagtgccgcagacccctggggggcccctgct
gctgccactgcgggctctgctggcccctcgcctccaccaacagttcctgcccctgctgct
tcagggccatggggcgcagccccctcggacccatggggggtggcgtcacccacatctcct
acaagctctgacccctggggtgggggagcaccgcccactatagcccctcctccagacccc
tggggagagacgtccaatagagtcaacaacgtcgacccctggggaagctcagccgtgacc
cccccaagtgccgacccctggggccccccagtgcctcccagcacttcctcctcggggggg
ccagtagacccctgggcaagggacgggcctgtccctgcctctgaccctatcacctccgac
atctggagtggcaccgccaaacacactaacggcacaggagacccagagcgacgagggtcc
tcagcaacaggctgtgacagcacaggctcaccggtgccctttgacctgtcgtctctcggt
tcttcacttcctgtacgcaagactccagagtccttcctcggccccaatgcagcactggtg
gatcttgattctctggtgtcatctaaacccaaacccaaacagccaccacctccctctatc
tcttcctcttcagcacacaatcccttcctccagaacacaggctcatctcctgctccgggt
atggcagtgactccaggcagcacaatctccagcaggggggtttccccaacacctgcctcc
tccaacccgtttggcgtggccccgcccatgacctccatctcacctcagccctcatctcta
ggcctgagtggcctccgcaccagtcccgtgcctcccaatcccatgctgggcatggtgcag
ccaggaatgggcatggggccaatgagtgtgggtatgggggctccaggaatgggcctgggc
atgatgcaggccagccccatgggcatgccctacagtggcctctctcctatggcgccacca
ggctcggctctgttggggcccggaggcactgcacctcctcagctgattttgggtgggcct
gctggaacaggaggagtgatgggggcaggaggatcagtgggaggcggaggaacgacggga
gcaagcaccaacccttttcttctttga

DBGET integrated database retrieval system