KEGG   Lates calcarifer (barramundi perch): 108888164Help
Entry
108888164         CDS       T04895                                 

Definition
(RefSeq) uncharacterized protein LOC108888164
  KO
K06854  thrombopoietin
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108888164
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lcf04052]
    108888164
Cytokines and growth factors [BR:lcf04052]
 Cytokines
  CSF and other factors
   108888164
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EPO_TPO
Motif
Other DBs
NCBI-GeneID: 108888164
NCBI-ProteinID: XP_018539519
LinkDB All DBs
Position
Unknown
AA seq 206 aa AA seqDB search
MQEGIILSATALSSLMATRQSPPLCAPLGLLLLLLIGVISSHLPEVQGKPIDFWCKDHAR
KSMETKLETLKKNMAHCNGSDWLPSPVQLPCIGVLKKDWENKALQHKCAEVIGALQVFQE
GVQGVSKKTTVECQTQLLRRLELNIKNHLVIVRRLLIQNDTVTSSDSAVQHCFNETNLNE
VLKQYGCLLRGKLTYLAKDVQDGLCT
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcaggagggtataattctgtctgctactgcattaagtagtttgatggcaactcgtcag
tcacctccgctgtgcgctccactagggctcctgctgctgctgctgataggagtgatttcc
tcccatctacctgaagtgcagggcaaacctattgacttttggtgcaaggatcacgccaga
aaaagtatggagacaaagcttgagacactgaagaaaaacatggctcattgtaatggttca
gactggctgccatctcctgtacagctgccatgtattggggtactcaaaaaagactgggaa
aataaagctctacagcacaagtgtgcagaggtaattggggccctccaggtttttcaagaa
ggagtgcaaggggtgagtaagaagaccacagtggaatgtcagactcaacttttgaggaga
ctggagctcaacatcaaaaatcatctggtcattgtcagaaggcttcttatacagaatgac
acagtgacatcgtcagattctgcagtacagcactgtttcaacgaaaccaatctgaatgaa
gtgctgaaacaatacggatgcctactccggggaaaactgacataccttgctaaagatgtc
caggacggcctctgtacttga

DBGET integrated database retrieval system