Lates calcarifer (barramundi perch): 108888449 Help Entry 108888449         CDS       T04895                                  Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism lcf  Lates calcarifer (barramundi perch) Pathway lcf03030   DNA replication lcf03410   Base excision repair lcf03420   Nucleotide excision repair lcf03430   Mismatch repair lcf03440   Homologous recombination Brite KEGG Orthology (KO) [BR:lcf00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     108888449    03410 Base excision repair     108888449    03420 Nucleotide excision repair     108888449    03430 Mismatch repair     108888449    03440 Homologous recombination     108888449  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:lcf03032]     108888449    03400 DNA repair and recombination proteins [BR:lcf03400]     108888449 DNA replication proteins [BR:lcf03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     108888449 DNA repair and recombination proteins [BR:lcf03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       108888449    MMR (mismatch excision repair)     DNA polymerase delta complex      108888449 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Umbravirus_LDM Phage_cap_E Motif Other DBs NCBI-GeneID:  108888449 NCBI-ProteinID:  XP_018539951 UniProt:  A0A4W6FVH3 LinkDB All DBs Position LG5:9714861..9718038 Genome browser AA seq 108 aa AA seqDB search MTTKHRLITDSFKVVKKARRGGKREKRSTPPPPQKEAETDTVRQEELQKLRQFDLDWRFG PCTGISRLQRWERAQLHGLNPPEEIRELLLKTHIDPEYKLSLWSEYPL NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgacgaccaagcacagactgataactgattcattcaaggtggtaaagaaagcaaggagg ggtgggaaacgagagaagagatctactcctcctccaccacagaaagaggctgagactgac acagtcagacaggaggagctgcagaagctcagacagtttgatctggactggagatttggg ccctgcacaggtatcagcaggctgcagagatgggagagagcacagcttcatggtctgaac ccacctgaggagatcagagagctgctgctgaaaacacacatcgatcctgagtacaagctg agcctgtggagtgaatatcctttgtga

DBGET integrated database retrieval system