KEGG   Lates calcarifer (barramundi perch): 108889336
Entry
108889336         CDS       T04895                                 

Definition
(RefSeq) pro-epidermal growth factor-like isoform X1
  KO
K08774  transforming growth factor, alpha
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04010  MAPK signaling pathway
lcf04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108889336
   04012 ErbB signaling pathway
    108889336
SSDB
Motif
Pfam: EGF Laminin_EGF Spore_III_AB
Other DBs
NCBI-GeneID: 108889336
NCBI-ProteinID: XP_018541246
LinkDB
Position
Unknown
AA seq 263 aa
MTRIFWDTIFLISGTFSMSVVFNGSLFTFGAGPSNSTIIEARISIDTNSTAAPNTSMGSS
ATTGSASTTTITTTSDVPVVKNSLFTFGAGQTDSQIIDAVISIDTNSSAAPNTSTTSSAT
TSSRGTTATTTATTTTSIPPVKKFVAAAVRSHFDDCPDSHRHFCFHGTCRFLILEETPAC
VCHPGFVGMRCEHADLLAVVATNHRQQTVATVLVLCVIGCVLIMVLCTLLHCWWRQDCRR
RRHALHYIPEKHGASYYPSESVV
NT seq 792 nt   +upstreamnt  +downstreamnt
atgacgcggattttctgggatacaatttttctcataagcggtacttttagtatgtctgtg
gtattcaatggttcactctttacatttggagctgggccgagcaattcgacaatcattgaa
gctcgcatttccatcgatacaaactccaccgctgctccaaacacctccatgggcagctct
gcaacaactggcagcgcaagcaccacaacgattacaaccacaagtgatgtccctgtggtt
aaaaattccctctttacatttggagcagggcagaccgattcacagattattgacgctgtc
atttccatcgacacaaattcctctgcagctccaaacacatcaacaaccagctctgcaaca
accagcagcagaggcaccaccgccacaactactgcaactacgaccactagcatcccccca
gttaaaaagtttgtggctgcggctgttcggtctcatttcgatgactgtccagactcccac
cgccatttctgcttccatggcacatgccgcttcctgatattagaggagacacctgcatgc
gtgtgtcatccaggcttcgtcgggatgaggtgtgaacatgccgacctgctcgctgtggta
gcaactaatcacagacaacagaccgtcgccacagtgctggtgttgtgtgttattggctgt
gttctgatcatggtgttgtgtacacttttacattgctggtggagacaggactgtcgcagg
cggagacacgcactgcactacatcccagagaagcacggagcatcctactatccatctgag
agtgtggtttga

DBGET integrated database retrieval system