KEGG   Lates calcarifer (barramundi perch): 108889337
Entry
108889337         CDS       T04895                                 

Definition
(RefSeq) ras association domain-containing protein 1-like isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
lcf  Lates calcarifer (barramundi perch)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 C1_2
Other DBs
NCBI-GeneID: 108889337
NCBI-ProteinID: XP_018541248
UniProt: A0A4W6DM76
LinkDB
Position
Unknown
AA seq 358 aa
MSKCELIELKDLSVSDPIELAAPAARTHPPPVNPGQPCSFHVVRLVGDSVTIEAPGCQTG
EAGVGHDFQTHSYAHLTWCDLCGEFIWGLYKQSLRCTKCNYTCHYRCRPFIQLDCSTDGS
LLADPEDFSVDSIETDTNVDEQIDFGKQKLSVGEIQQKVKEYNAQINNNLYMVANKDGSY
TGFIKVHFQLVRPISLPPPQNLCSTQEEDQRARRMKRRTSFYLPKDTAKHLHISSQTRVR
EVIEALLNKFTVVDNPGKFALFERTERQSQVYMRKLSDEECPLYLRLCAGPSEKVLSLVL
KENETGDVNWDAFSFPELCNFLRILQREEEEHVRQIVKRYALARERMKQAMAKITTPG
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgtctaaatgtgagctgatcgagctgaaggacctcagtgtaagtgatcccattgagttg
gctgcgcctgcagcccgcacgcatccgccaccagtgaacccaggtcagccctgctccttc
catgtcgttcgcctggtcggagacagcgtcaccatcgaggcgcccgggtgtcagacggga
gaggccggagtgggtcatgacttccagacccacagttacgctcatctcacctggtgcgac
ctgtgtggagagttcatctggggtctttataagcagagtttacgctgcaccaagtgcaat
tatacttgtcactaccgctgccgaccattcatccagctggactgcagcacagatggaagt
ttgttagcagaccctgaggatttctctgtcgactccatcgagacagacacgaatgtggat
gaacagattgattttggtaaacagaagttaagtgttggtgagattcaacagaaggttaag
gagtataatgctcagatcaacaacaatctctacatggtggctaataaagatgggtcatac
actggtttcatcaaggtccactttcagttggttcgtcccatctccctccctcctcctcag
aacctgtgctcgacgcaagaggaggatcagcgggccaggcggatgaaacgacggacgtct
ttctacctccccaaagacactgcaaaacacctgcacataagctctcaaacacgggtacgg
gaagtcatcgaggcgcttctcaacaagttcaccgtggtggacaacccgggcaagtttgcc
ctgttcgaacgcactgagagacaaagtcaagtgtacatgcgtaaactatctgatgaggaa
tgtccactctacttacgcttgtgtgctggccccagtgaaaaagtcctgagtctggttttg
aaagaaaatgagacgggggatgtcaattgggatgcatttagctttcctgagttgtgcaac
tttctgcgaatcctgcagcgcgaagaagaagagcacgtccggcagatcgtgaagcgctac
gctcttgccagagagaggatgaagcaggccatggcgaagattacgactcctggttga

DBGET integrated database retrieval system