KEGG   Lates calcarifer (barramundi perch): 108889409Help
Entry
108889409         CDS       T04895                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type 1-like
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    108889409
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lcf01001]
    108889409
Enzymes [BR:lcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     108889409
Protein kinases [BR:lcf01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   108889409
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal RIO1 Kdo APH YrbL-PhoP_reg RTBV_P46 FTA2
Motif
Other DBs
NCBI-GeneID: 108889409
NCBI-ProteinID: XP_018541358
LinkDB All DBs
Position
Unknown
AA seq 380 aa AA seqDB search
MPLGDDCHAWKKKTTDVKENYDFKEILGTGAFSEVVLAEEKRTQKLVAIKCIPKKALEGK
ENSIENEIAVLHKIKHANIVSLEEIFESKSHLYLVMQLVSGGELFDRIIEKGFYTEKDAS
KLIQQILDAVKYLHDMGIVHRDLKPENLLYYSMDEDSKIMISDFGLSKIEGSGSVMSTAC
GTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDS
PYWDDISDSAKDFIVHLMEKDPNIRYTCEQALQHPWIAGDTALDKNIHESVSAQIKKNFA
KSKWKQAFNATAVVRHMRRLQLGTSHEGPSPTLPSPCRTHLLMPEEDAEACCEGGCSQNV
DGGADPLSNCTYRCHPTSRV
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgccactgggtgacgattgccatgcctggaaaaagaagaccacagatgtgaaggagaac
tatgacttcaaagagatcttgggaacgggagcgttctctgaggtggtcctggccgaggag
aagaggacccagaagttggtggctatcaagtgtatccccaagaaggcattagaggggaaa
gaaaacagcattgagaatgagatagcagtcctgcacaagattaaacatgccaacattgta
tctctggaagagatatttgagagtaaatcacacctctaccttgtcatgcaactggtatct
ggtggggagctctttgatcgcatcatagagaagggcttctacacagagaaagatgccagt
aagctcattcagcagattctggacgctgtcaaatacctccacgacatgggcattgtgcac
cgtgacctcaagccagagaatttgctgtactacagcatggacgaggactccaaaatcatg
atcagtgactttggtctgtctaaaatcgagggctctggcagtgtgatgtcgacggcctgt
ggaacacctggatatgttgcccctgaagtattggctcagaaaccctacagtaaagcagtg
gactgctggtctattggtgtcatagcctatattctgttgtgtggttaccctcccttctac
gatgagaacgatgccaaactgtttgagcagatcctgaaggcagaatacgagtttgactct
ccttattgggacgatatctctgactcagccaaagactttatagtccacctgatggagaaa
gaccccaacatacgttacacctgtgagcaggctctgcagcacccctggattgctggggac
actgccctggataagaacatccatgagtctgtcagtgcccagataaaaaagaattttgct
aaaagcaagtggaagcaagcattcaacgccacagcggtggttcgtcacatgaggcgtctc
cagctgggcaccagtcatgagggacccagccccaccctgcccagcccgtgccgaactcat
ctgttgatgccagaggaagatgcagaggcttgttgcgagggagggtgctcccagaacgtt
gacggcggggcagaccccctgtccaactgcacctaccgctgccacccgaccagcagggtg
tga

DBGET integrated database retrieval system