KEGG   Lates calcarifer (barramundi perch): 108890542
Entry
108890542         CDS       T04895                                 

Definition
(RefSeq) uncharacterized protein LOC108890542
  KO
K05461  KIT ligand
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04010  MAPK signaling pathway
lcf04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108890542
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    108890542
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lcf04052]
    108890542
Cytokines and growth factors [BR:lcf04052]
 Growth factors
  Growth factors (RTK binding)
   108890542
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 108890542
NCBI-ProteinID: XP_018542938
UniProt: A0A4W6BJ72
LinkDB
Position
Unknown
AA seq 202 aa
MRKKILKAPCLLLSLFTSLNLCSGKFGTPITDDVSKLSLLKQNIPSDYEIPVSYIPKEVA
GTCWVVLNIYPLEQSLRKLANMFGAISSNKENIIVFIAMLKSLRFTFDHEELETAMQVFQ
CHYQEGSLMSGLYFDYIKDVLHSAAQGTSGFSCKPPPCLNPQQTPGGQEDSRKYSWSKRT
PLLLVLIPFVACLILIVWLVST
NT seq 609 nt   +upstreamnt  +downstreamnt
atgaggaagaaaatcttgaaagcaccttgtctcctcttgagtctgttcaccagtttgaat
ctctgctctggaaaatttgggacgccaataactgatgatgtgagcaagctgtcgttactg
aagcagaatatcccctctgattatgaaattcctgttagttacattcccaaagaagtggct
ggcacgtgctgggtggtgttaaatatctatcctttagagcaaagtcttcggaagctggcc
aatatgttcggtgccatttcctccaacaaagaaaacataattgtcttcattgcaatgctg
aagagtttacgcttcaccttcgaccatgaggaactggaaacagcgatgcaagtcttccag
tgtcactaccaggaagggagcttaatgtctggtctttacttcgactacatcaaagacgtc
ttacactctgccgctcaaggaacatccggcttctcgtgcaagccgccaccatgtcttaac
ccgcaacagacaccagggggtcaggaggacagtcgtaaatacagctggtcgaagagaaca
cctttgcttttggtcctcatccccttcgtcgcttgtcttattctcatagtgtggctggtg
agtacctga

DBGET integrated database retrieval system