KEGG   Lates calcarifer (barramundi perch): 108890565Help
Entry
108890565         CDS       T04895                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1D-like
  KO
K04853  voltage-dependent calcium channel L type alpha-1F
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04010  MAPK signaling pathway
lcf04020  Calcium signaling pathway
lcf04260  Cardiac muscle contraction
lcf04261  Adrenergic signaling in cardiomyocytes
lcf04270  Vascular smooth muscle contraction
lcf04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108890565
   04020 Calcium signaling pathway
    108890565
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    108890565
  09153 Circulatory system
   04260 Cardiac muscle contraction
    108890565
   04261 Adrenergic signaling in cardiomyocytes
    108890565
   04270 Vascular smooth muscle contraction
    108890565
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lcf04040]
    108890565
Ion channels [BR:lcf04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   108890565
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH PKD_channel
Motif
Other DBs
NCBI-GeneID: 108890565
NCBI-ProteinID: XP_018542982
LinkDB All DBs
Position
Unknown
AA seq 2081 aa AA seqDB search
MYEESRKSGGHNGYTKAVDGEEGGEEGEEEEEGGEGDGAGEGGGGGGEERDAEWDEELDG
ENEGGVRMTRTDTLHSTTSSTGTQRKRGQHAKKQVQGSNQVQRAPRALFCLKLNNPIRRA
ALSIVEWKPFDIFILLAIFANCVALGVSKPFPEDDSNSTNHDLEQVEYVFLIIFTVETFL
KILAYGLVMHPSSYIRNGWNLLDFVIVIVGLFSVVLETMTHKSGEQATTHHMPGKPGGLD
VKALRAFRVLRPLRLVSGVPSLQIVLNSIMKAMVPLLHIALLVLFVIIIYAIIGLELFIG
RMHRTCYYTGTDNYVEDDPVPCAFAGHGRQCTVNGSECRGRWDGPNGGITNFDNFFFAML
TVFQCITMEGWTDVLYWMNDAIGFELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREK
AKARGDFQKLREKQQMEEDLCGYMDWITQAEDMDDLDEDGNPRPSLGDLSDKKRGKFGWF
SHSNETHASLPASETASENTENIDEEHTNCCQACCAKMMKISCCRTLRRWNRVCRRNCRT
AVKSVTFYWLVLLLVFLNTSLSASEHYDQPEWLTQVQDIANKVLLSLFTVEMLLKMYSLG
LAHYFVAFFNRFDCFVVCGGIVETILVEMDIMPPLGISVLRCVRLLRIFKVTRHWTALSN
LVASLLNSMKSIASLLLLLFLFLIIFALLGMQLFGGKFNFDETQTKRSTFDAFPQALLTC
FQILTGEDWNVVMYDGIMAYGGPVFPGMIVCVYFVILFICGNYILLNVFLAIAVDNLAGG
DGDDKKKEKKKEGAEEEEEEAEEGEVKVDVDEDTEYEEEEELPEGDDDGGVQLKMADLAP
PKEKVLPIPEGSAFFCLSKTNPIRVACHTLIHHHIFTNLILVFIILSSCSLAAEDPIRAH
SFRNNILGYADYAFTSIFTVEILLKMTVHGAFLHQGSFCRNWFNLLDLLVVSVSLVSFFL
HSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACI
GVQLFKGKFYRCTDEAKHTPEQCKGTFVVYKDGDVSHPMVRQRLWQNSDFNFDNVLMGMM
ALFTVSTFEGWPALLYKAIDANGENSGPIYNYRVEISIFFIVYIIIIAFFMMNIFVGFVI
ITFREQGEQEYKNCELDKNQRQCVEYALKAQPLKLYIPKNPVQYKFWSIINSTGFEYVMF
VLILLNTVTLAVQHYEQSKTFSYIMDILNMVFTGLFTVEMLLKLLALRLRHYFVDAWNSF
DALIVVGSVVDIVVTEFSSGEDSSRVSITFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSL
QALPYVALLIAMIFFIYAVIGMQTFGKIAMQDYTQINRNNNFQTFPQAVLLLFRCATGEA
WQEIMLASLPGKRCDPESDYEPGEEFSCGSNFAIVYFISFFMLCAFLIINLFVAVIMDNF
DYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVALLRRIQPPLGFGKLCPHRVA
CKRLVAMNMPLNSDGMVTFNATLFALVRTALKIKTEGNPDQENEELRVIIKKIWKRMKPK
LLDEVIPPHEEEEVTVGKFYATFLIQDYFRKFRKRKEKGDLTGESDSTNPSAVQLCKAGL
KTLQDLGPEMRLALNEDLEEEEEALMEDEELEENAAYKGENGFGPEKDRRGSILTTPTGP
GGVVGDGGLSNGGLIHRVGSLTKMPNGSEHDEHLHRGDNMRSSVNHHHHRRPSVKNGLLD
HTHKRPSYYKHGRRDSRDRYWRNGDMEAYGEQGYYSREEDNDSITSRDRHYPDEPPLYRD
HYDGHAPYNSSYGNGYSEGRRMTRRRLLPATPTGRKPSFNIQCLRRQGSSDDLPIPGTYH
PTSPPRRTRTQMFSSYESRHSSGRSSAASSASWANSCPRRGRLLYAPLILVEEEGSPPWG
GGGGGGGPGGEGKKGGAGRGVSVTGAAPRPAWYSGPAGTSAPPPYRAYTTLRVPSQLGAQ
FTEKRGSADSLVEAVLISEGLGLYARDPKFVAFAKREIADACHMTVDEMESAASDLLGSG
SHGFLSNAATDPAALYSDEEPIRTGRDEDELADEMTCVTSF
NT seq 6246 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaagaaagccgaaaaagtggcggtcataacggctacaccaaagcagtggatggg
gaggagggaggagaggagggggaggaagaggaggagggaggagagggagatggagcagga
gagggaggaggaggaggaggtgaggagagagacgcagagtgggacgaagagctggatgga
gagaacgagggaggcgtgaggatgacgagaaccgacacacttcactcgaccacaagttcg
accggaacacagaggaagagaggacaacacgctaagaaacaggtgcagggcagtaatcag
gtccagcgagctcctcgagcgttattctgcctgaaactcaacaatccaatcagacgagcc
gctctctctatcgtcgagtggaaaccgtttgatatcttcatcctgttagccatctttgct
aactgtgtcgctctgggagtttctaaaccgtttcctgaggacgactccaactccaccaac
cacgacctggaacaagtggagtatgtcttcctcatcatcttcactgtggagaccttcctg
aagatcttagcctatggtctggtgatgcaccccagctcctacatccgcaacggctggaac
ctgctcgacttcgtcatcgtcatcgtcgggttgttcagtgttgtcttggagacaatgact
cataaatctggtgagcaggcgactacgcaccacatgccaggaaaacctggaggtctggac
gtcaaagctctgagagccttcagagtcctgaggcccctcaggctggtctctggagtcccc
agtctgcagattgtgttgaactctatcatgaaggcaatggttcctctgctccacattgct
ctgctggttctcttcgtcatcatcatctacgccatcatcggtctggagcttttcattgga
cgcatgcacaggacctgctactacacaggaacagataattatgtggaggatgacccagtg
ccatgtgcatttgccggtcacggtcgtcagtgcaccgttaatggctcagagtgtcgaggg
aggtgggacggtcccaacggaggaatcaccaactttgacaacttcttctttgccatgttg
actgtgttccagtgcatcaccatggagggatggaccgacgttctgtactggatgaatgat
gccatagggttcgagctgccctgggtttattttgtcagtctggtgattttcggctcgttc
ttcgttctcaacctggttctgggagtcctcagtggagagttcagtaaggagagggagaag
gcgaaggctcggggagatttccagaagctgagggagaagcaacagatggaggaggatctg
tgtggatacatggactggatcactcaggctgaggacatggatgatctggacgaagatgga
aacccacgtccgtctctgggtgatctgtcagataagaagagagggaagtttggatggttc
agtcactccaatgaaacacacgcgagtcttcctgccagtgaaacagcttctgaaaacacc
gaaaacatagacgaggaacacaccaactgctgccaggcctgctgtgcaaagatgatgaag
atcagctgctgtcggactctgcggaggtggaatcgtgtttgtcgtagaaattgtcgaaca
gctgtgaagtcggtgacgttttattggctcgttctgctgctcgtcttcctcaacacctcc
ctcagtgcctctgagcattacgaccaacctgagtggctgacacaagtccaggacatcgcc
aacaaggtgctgctgtctctgttcaccgtggagatgctgttgaagatgtacagtctgggt
ctggctcattacttcgtggcgttcttcaaccgcttcgactgcttcgtggtgtgcggcggc
atcgtggagacgatcctggtggagatggacatcatgcctcctctgggcatctcggtgctg
cgctgcgtccgcctgctccgcatcttcaaggtcacacgccattggacggctctgtccaac
ctggtggcgtccttgctgaactccatgaagtccatcgcctccctgctgctgttgctcttc
ctcttcctcatcatcttcgctctgctcggcatgcagctgttcggaggcaagttcaacttc
gatgagacgcagaccaaacgcagcaccttcgacgccttcccgcaggcgctgctcacctgc
ttccagatcctgacaggtgaggactggaacgtggtgatgtacgacggcatcatggcgtac
ggaggacctgtgttcccggggatgatcgtctgcgtttacttcgtcatcctcttcatctgt
ggaaactacatcctgctgaacgtcttcttggccatcgctgtggacaacctggccggagga
gacggagacgacaagaagaaagagaagaagaaggagggagctgaggaggaggaggaggag
gctgaggaaggagaagtgaaggtggacgtggacgaagacactgagtacgaggaggaggag
gagcttcctgaaggagacgatgatggaggagtccagttaaagatggccgaccttgctcct
cctaaagaaaaggttcttccaatcccagaaggcagtgcgttcttctgcctcagcaaaacg
aacccgatccgtgtggcctgtcacactctgatccaccaccacatcttcaccaacctcatc
ctcgtcttcatcatcctcagcagctgctcattggctgctgaggatccaatcagagcacac
tccttcaggaacaacatcctgggttacgcagactacgccttcacctccatcttcaccgta
gagatcctgttaaagatgacggtccacggagcgttcctccatcagggctcgttctgcagg
aactggttcaacctgctggatctgctggtcgtcagcgtgtctctggtctccttcttcctg
cactccagtgcgatctcggtggtgaagatcctgcgagtcctccgggtgctcagacctctg
agagccatcaacagagccaaaggactgaagcacgtggtccagtgtgtgtttgtggcgatc
aggacgatcggaaacatcatgatcgtcacaactctgctgcagttcatgttcgcctgcatc
ggagtccagctcttcaaggggaaattttatcgctgcacagatgaagccaaacacacccct
gaacagtgcaaagggaccttcgtcgtgtataaggacggggatgtgagtcacccgatggtc
cggcagcgtctgtggcagaacagtgactttaactttgataacgtgctgatggggatgatg
gcgctcttcactgtctccacctttgagggctggcccgcgctgctgtacaaagccatcgac
gctaacggggagaactctggtcccatctacaactaccgggtggagatctccatcttcttc
atcgtctacatcatcatcatcgccttcttcatgatgaacatcttcgtgggtttcgtcatc
atcaccttcagagagcagggagagcaggagtacaagaactgtgagctggacaagaaccag
cgtcagtgtgtggagtatgctctgaaggctcagccgctcaaactctacatcccaaagaat
ccggttcagtacaagttctggtccatcatcaactccacaggcttcgagtacgtcatgttc
gtcctcatcctgctcaacaccgtcactctggctgtccagcactacgaacagtccaaaacc
ttcagctacatcatggacatcctcaacatggtgttcactggactcttcactgtggagatg
ctgctgaagctgctcgctctcagactcaggcattacttcgtggacgcctggaactcattt
gacgctctgatcgtggtcggcagcgtggtcgacatcgtggtcacagagttcagcagcgga
gaggacagctccagagtctccatcaccttcttccgtctgtttcgagtgatgcgattggtc
aagctgctgagtaaaggggaggggattcgtacgctgctgtggacgttcatcaaatcgctg
caggctctgccgtacgttgctctgctcatcgccatgatcttcttcatctacgccgtcatc
ggcatgcagacgtttgggaagatcgcgatgcaggattacactcagatcaacagaaacaac
aacttccagacttttcctcaggctgttctcctcctcttcaggtgtgccacaggtgaggcg
tggcaggagatcatgttggccagcctcccaggtaaacgctgtgaccctgagtcagactat
gaaccaggagaagagttcagctgcggcagcaacttcgccatcgtttacttcatcagcttc
ttcatgctgtgtgctttcctgatcatcaacctgttcgtcgctgtcatcatggacaacttt
gactatctgacacgtgattggtcgattctgggaccacatcacctggatgagtttaagagg
atctggtctgagtacgacccagaggccaagggtcgtataaaacacctggatgttgtggct
ctgctcaggaggattcagcctcctctgggctttgggaagctttgtcctcacagagtggcc
tgtaagcgtctggtggcgatgaacatgcccctgaactctgatgggatggtgacctttaac
gccacactcttcgctctggtccgcactgccctcaagatcaagactgaaggtaaccctgac
caggagaacgaggagctgagggtgatcatcaagaagatctggaagagaatgaaaccaaaa
ctactggacgaggtcataccaccacacgaagaggaggaagtaacagttgggaagttttac
gcaactttcctgatccaggattatttcaggaagttcaggaagaggaaagagaaaggagat
ctgaccggagagtccgactccaccaacccgtctgctgtacagctgtgtaaagccggtctg
aagactctgcaggatctgggtccagagatgcgtctggctctgaacgaggacctggaggag
gaggaggaggccttgatggaggacgaagagctggaggagaatgctgcgtacaagggtgaa
aacgggtttggaccagagaaagatcgacgaggctccatcctgaccacgcccactggtccc
ggtggtgttgtcggtgacggaggtctgtctaatggaggtctgatccaccgggtgggttct
ctcaccaagatgccaaatggcagcgaacacgatgaacaccttcaccgtggagacaacatg
aggtcatctgtcaatcatcatcatcaccgccgcccgtcagtgaagaacggcctgctggac
cacacccacaagagaccttcatactacaagcatggaaggagggactcaagggacagatac
tggaggaacggggacatggaggcgtacggagagcaaggttactacagcagagaggaagac
aacgacagcatcacctccagagacagacattatcccgacgagcctcctctgtacagagac
cattatgatggccacgccccctacaacagtagctatggtaacggctacagcgagggcagg
aggatgacccggagacgcctacttcctgccacgcccacaggtcggaaaccgtcctttaac
atccagtgtctgaggagacagggcagcagtgatgacctgccaatccccgggacgtaccac
cccacctcaccgccacgccgcacacgcacacaaatgttcagcagttacgagtctcgtcac
tcctccggtcgctcctcggcagcctcctcggcatcctgggcgaactcgtgtcctcgccgc
ggacgcctcctctatgctcctctcatcctagtggaggaggaaggcagcccgccttggggg
ggaggaggaggaggaggaggacctgggggtgaggggaagaagggaggagcaggaagaggt
gtcagtgtgactggggcggcgcccagaccggcctggtacagtggccccgcagggacatca
gcgccgccgccgtacagagcctacaccaccctcagagtcccctcgcagctcggagctcag
ttcacagagaagcgagggtcggccgacagcctggtggaggcggtcctgatctccgagggt
ctcggtctttacgctcgggatcccaagttcgtggcgtttgcgaagcgggagattgctgac
gcgtgtcacatgaccgtggatgagatggagtcggccgccagcgacctgctcggctccggg
agccacggcttcctcagcaatgcagccaccgaccctgccgcgctctacagcgatgaggag
ccaatcaggacgggccgggacgaggacgagctggccgacgagatgacctgtgtgacatca
ttctga

DBGET integrated database retrieval system