KEGG   Lates calcarifer (barramundi perch): 108890602
Entry
108890602         CDS       T04895                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04012  ErbB signaling pathway
lcf04068  FoxO signaling pathway
lcf04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108890602
   04068 FoxO signaling pathway
    108890602
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108890602
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 108890602
NCBI-ProteinID: XP_018543040
LinkDB
Position
Unknown
AA seq 191 aa
MCNKMSDVRLSNASPTLERVDARQQDNRRPSVCRNLFGTPDREGLQRNAEAHRQEELQAF
RERYNFDPETDRPLSPGNYAWEEDSNPPEFYLRPPHGTQRPQRDADSPGDNNTRRDAEER
SGRRPNHQPDREGSRKRRPGPPGPCSGECQNKKPHTDGDDDEDQSDRGAGSQAVKAAEER
PNRPENGAEVQ
NT seq 576 nt   +upstreamnt  +downstreamnt
atgtgcaacaaaatgtcagatgttcgcctttctaatgcgagcccgacattggagagggtg
gatgcgcggcagcaggacaaccgcagaccttcggtttgcagaaatcttttcggcacacct
gaccgagaggggctacagaggaatgctgaggctcacaggcaggaagaactgcaggctttt
agggaaaggtacaattttgatccggagaccgacaggccgctctctccgggcaattacgcg
tgggaggaggacagcaacccaccggagttttatctcagaccgcctcacgggacccagcgg
ccccagcgagatgcggactcacccggcgataataacacccggcgggacgccgaggagagg
agtgggaggcggccgaatcaccaaccggaccgagagggttcgaggaaaagacgtccagga
cctccaggtccctgctccggcgagtgtcagaataaaaagccgcataccgacggagatgat
gatgaagaccagtcggaccgaggtgcaggaagtcaggcggtgaaagccgcggaggagaga
cccaacaggccagagaacggcgcggaagtccagtga

DBGET integrated database retrieval system