KEGG   Lates calcarifer (barramundi perch): 108890605
Entry
108890605         CDS       T04895                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04012  ErbB signaling pathway
lcf04068  FoxO signaling pathway
lcf04110  Cell cycle
lcf04115  p53 signaling pathway
lcf04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108890605
   04068 FoxO signaling pathway
    108890605
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108890605
   04115 p53 signaling pathway
    108890605
   04218 Cellular senescence
    108890605
SSDB
Motif
Pfam: CDI SR-25
Other DBs
NCBI-GeneID: 108890605
NCBI-ProteinID: XP_018543046
LinkDB
Position
Unknown
AA seq 190 aa
MKTGDMAMASPSASIAGPATVSELSRLGGIEALNLKVGPARRNLFGPVDHQQLQQDFQRL
LCMSVEVANKRWNFDFQTDVPGEGANIEWEELKCQDVPAFYRSCMVRPAARSPGVAGMAK
STWRTSSSSGEGSPMSSSSSGSGSGDEYLEVTTRGCYRIQRSGKRRQSAITDFFKVKKRR
LLHYKASSRQ
NT seq 573 nt   +upstreamnt  +downstreamnt
atgaaaacaggggacatggccatggcctctccatcagcatcaatcgcaggaccagctacg
gtatctgagctctcccgcctggggggcatcgaggccttgaatctgaaggtgggaccggcg
cggcggaacctcttcgggcccgtggaccaccagcagctgcagcaggacttccagaggctt
ctctgcatgagcgtggaggtggccaacaagcggtggaacttcgatttccagaccgacgtg
ccgggggagggcgccaacatcgagtgggaggagctcaagtgccaggacgtgccggcgttt
taccgcagctgcatggtgaggccggcagcgcggagtcctggcgtcgcagggatggcgaag
agcacgtggcggacgtcgtcttcatcaggcgagggttccccgatgtccagcagctcatcc
gggtctgggtctggcgatgagtaccttgaggtgactaccagggggtgctacaggattcaa
cggtcagggaaacgcagacagtccgccatcacagatttcttcaaggtgaagaagaggagg
cttctgcattacaaagcctcttccaggcagtag

DBGET integrated database retrieval system