KEGG   Lates calcarifer (barramundi perch): 108891249
Entry
108891249         CDS       T04895                                 

Gene name
atf6b
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04141  Protein processing in endoplasmic reticulum
lcf04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108891249 (atf6b)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108891249 (atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lcf03000]
    108891249 (atf6b)
Transcription factors [BR:lcf03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    108891249 (atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf YabA Chorion_2 MCU DUF4140
Other DBs
NCBI-GeneID: 108891249
NCBI-ProteinID: XP_018543879
UniProt: A0A4W6F0W9
LinkDB
Position
Unknown
AA seq 721 aa
MSTDLLSELDSRFFADNLLTSEDWDACLYQCESMEEGEDGDFRGLKYDTSFDNDLVLTLD
PDNPTSPWQHSDDNLLTGDTPVIKNEMTITQPLPVEMLFQVKAEPPSPASSLGSDCSISS
PDSQITVKGENPPTPPYMYGDVLSPPLGSMEVTVATTAVPPPQTQLPAVTQTPLTTQIPA
VISGLQTQATVLPGSATLKASTILSTKPPIQPRPVCVTTLPVPQTPAPAKTLILQGLPSM
DQTRPVVLSQSVCLGSAPAIVKMEPVSPSIPQHCSSPTAPPTSKPIVPATTTLPGNNSSD
IDMKVLKRQQRMIKNRESACQSRKKKKEYLQNLEAQLREAQQENERLRRENQALRERLAG
KEGSDSASNKRAVCVMAVLLFMTFSFGPVSITDKRLSTGLQESVVSYTGRRLLEIEQQQQ
RQQAAAQPPSRVEDKTETEEDGAEAEKYASESYQFRNLSDVFSDMKDLVLQDIDRYFTSS
DCRQFNRSESLRLADELRGWVHRHQIDRKKSGGKPKIAKKAKIAQKAQLRKTNFSRYLPI
QTHRSIESQLQVLPGPEVTYSDFLDAIDRREDTFYVVSFRRDHLLLPAISHNKTSRPKMS
LVMPAMSVNESLYNSSQGYEMMMQVDCEVMDTRIVPIKSSAVPPSLRDPPPPPPSSHHNP
HHHHHHHGNHTSLRGRHQHHPSSSPSSSSPSSASSSSSAPRQPLPARRPTAEYLISQSEG
V
NT seq 2166 nt   +upstreamnt  +downstreamnt
atgagcacggacctgctatctgagctggacagccgtttcttcgctgataacctcctgacc
agcgaagactgggatgcctgcctgtaccagtgtgagagcatggaggagggagaggacgga
gacttcagggggttgaaatacgacacgtcgtttgacaatgacctcgtgctcaccctcgat
cctgacaaccctacgtcaccgtggcaacacagtgacgacaacctgctcacaggagacact
ccggtaataaaaaatgaaatgacgattactcagcctctaccagtggaaatgttgttccag
gtgaaagctgagcctccctctcctgcgtcgtcactcgggtctgactgctccatatcatct
ccagactcgcagatcacagttaaaggtgaaaaccctccgactccaccctacatgtacgga
gatgtgctctctcctccgctgggatccatggaggtcaccgtggcaacaacagccgtaccc
ccaccacagacgcagcttcctgctgtaacacagacaccgttaacaacacagatcccagcg
gtcatcagcggattacagacgcaggctacagtcctgccaggttcagccacattaaaggcc
agcaccatcctgagcacaaaacctcccatccagcccagacctgtgtgtgtcaccaccctc
cctgtcccccagaccccggcaccagccaagaccctcatactgcagggcctcccctccatg
gaccagaccagacctgtcgtcctgtctcagtccgtctgtctcggttcagctccggccatc
gtcaagatggagcccgtgtctcccagcatcccccagcactgctccagccccacagcccct
cccaccagcaaacccatcgtcccggcgaccacaacgttacccggcaacaactccagtgat
attgatatgaaggtgctgaagcggcagcagaggatgataaagaaccgggagtcggcctgc
cagtcgaggaagaagaagaaggagtacctgcagaacctggaggctcagctcagggaggcc
cagcaggagaacgaacgactccgcagggagaaccaggcgctgagggagagactggctggg
aaagagggcagcgactctgcgagtaacaagagagctgtttgtgtcatggccgttctgctg
ttcatgaccttcagcttcggacctgtcagcatcacagacaagaggctgtcgacgggtcta
caggaaagcgtggtgtcgtacacgggacggcggctgctggagatcgaacaacaacaacag
cggcagcaggcggctgctcagcctccgagcagagtggaggacaagacggagacggaggag
gacggagcagaggcagagaaatacgcctcggagtcctatcagttcaggaacctgagcgac
gtcttcagcgacatgaaggacctggttcttcaggacatcgaccggtacttcacgtcctca
gactgcagacagttcaaccgctccgagtcgctcaggttggcagacgagctgagaggttgg
gttcaccgacatcagatcgacaggaagaagtctggaggaaaaccaaagatcgccaagaag
gccaagatcgcccagaaagctcagctgaggaagaccaacttctccagatatctgcccatc
cagactcatcgctccatagagagtcagctgcaggtgcttcctggtcctgaggtcacctac
agcgacttcctggacgccatcgaccgcagagaggacacgttctacgtcgtgtctttcaga
cgggaccacctgctgttaccggccatcagccacaataaaaccagcagacccaaaatgtct
ctggtgatgccggccatgtccgttaacgagagtctgtataactcctctcagggttatgag
atgatgatgcaggtcgactgcgaggtcatggacactcgaatcgtccccatcaagtcctcc
gccgtccctccatctctccgcgaccctcccccgcctcccccctcctcccaccacaaccct
caccaccaccaccatcaccacggcaaccacacctcgctccgaggacgccaccagcaccac
ccgtcctcctctccctcgtcctcctctccgtcctcggcctcctcctcctcgtcggctccg
aggcagcctttacccgcccggcgaccgacagctgaatatttgatcagccagtcagaaggg
gtctga

DBGET integrated database retrieval system