KEGG   Lates calcarifer (barramundi perch): 108891907Help
Entry
108891907         CDS       T04895                                 

Gene name
setd2
Definition
(RefSeq) histone-lysine N-methyltransferase SETD2 isoform X1
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108891907 (setd2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lcf03036]
    108891907 (setd2)
Enzymes [BR:lcf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     108891907 (setd2)
Chromosome and associated proteins [BR:lcf03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108891907 (setd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW
Motif
Other DBs
NCBI-GeneID: 108891907
NCBI-ProteinID: XP_018544780
LinkDB All DBs
Position
Unknown
AA seq 2636 aa AA seqDB search
MGEPCDLKHFVKEEGSGASVKVEGLSKAALIKSLSPRVMLSNHFLHKGTKTKVNLEDQSR
QKVSFSFAQTKKPLQSLFFIPASPEKSVAEPQAASSQSTSDKGGQSTDSKTEQTPMVPTS
IAETPSQTVSSATKPKPDLAKIHFKKQILSVSVTEEKPTSVMPEEQLSSELQVLQKSTSN
SATEFPTPQPQNVVSVCPSENAHIETSETRVTPSLKKPVASSGKDGETSSSTEQDNKVYK
RKTRSHSDSAPPGSESDGDSVHISSIRKSVDSKSKTNTDSRSKEVKKSSSSSHLEEKEKS
SSKRSENHERSSSYSKSERDSRHTSSRSARSDKDYRRSRSRSRSRSRASRTSSSHSRSER
SRGDRGSRSERSYYHDSDRRSHRSSPRRERRRSRSRTDRTRDSSDSEDDHRKTRTRTSDS
SRSSVHPSSHKESKSSYSKSEKVSKSVDSPHSLEFDKRTQSSKSERTSKRLSDSDSQRKC
SPDLNSSYRKSSTHHKSETNSKSSSSSMHTHSQTYEKCQKSSSSDSEADHKGKSQGSDKS
SGSEERSKDSFKKTSRPDSKQMTPSRSSVKTTGHDRQSDDMFYSSSKAPSCATTTELCSW
SEKLKSDSHQDGNEDVEEMVSWTEKGLQESLSKRAKETKSGLEVENKNTSAITSSESLKH
VNVALENLTNVKDSLSSDNRPHMNSNAAVLNSSSSNDSMVSSLDKKVSDHSPRPKSGPDA
ADTSVTHDIRQNTKPEIVELNEVDKQSDTSVPLKLESSCIESENQRSCGQQSMDTVKKSC
STTKKSRWDIVGQDASESDNSQRTLSTESKPTVKKVISVKKIEFSKDNIQQDSDIKDNIE
QEAETHSTLVKQTEISKQEFGSDSTSMIDKCKDQSEPSQASTSIDHCDLKLTVSQKANTD
EPLHINDTLQVDTAAKLKSWNEGDHDEKSKDSDHKSKLSKSTSLHQDAFGGQSEASDSDN
SEYDSDCGEAIKRLHSVVVVPKNSSLTMDTQDKGASCSPMNISELHNANIAADMSTYDVP
NQVSSQQRQGSPFIAFGETIGPCAGANDASNSGMLCQSQSNMIDSTSHSEGSSSVSALPY
MASHVSAHRSATDPANSLDNSRQCEQGQHTTSSRDERMYPQYQPNNFSNSDNISDKHGFT
IGWDFSQPEQPSSTYQQPDSSHGPQLPNTKLMGTSPKGQEHRHSNASWNHQSPNMQTSRK
TYLHAHEHYQDSAGEIHPDSLTNDHEDYSGDKNISKTALEWSGPNTPGSSSFVQGHEISS
NSRGSAVPDPPREDSFRPHRSRGPPKKRRPEIESDSDNEAEAGPAGKRERQGDTYVSKEN
LVKAEVHRPSLNLQDFQDANKWKDLAKSKKMPPYFDLIEENLYLTERKKSKSHRDIKRMQ
CECPVLPREERSRGVLACGEDCLNRLLMIECSSRCLNGVYCSNRRFQMKQHADFEVILTE
DKGWGLRAAKDLAPNTFVLEYCGEVLDHKEFKTRVKEYARNKNIHYYFMSLKNNEIIDAT
LKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKAVTAGTELTFDYQFQRYGKEAQKC
FCGAPSCRGFLGGENRVSVRAAGGRMKKDRSRKSALTTVDEELEALLENGEGLYDEKQVV
SLCRLMVRVETMEQKLICLKLIQDTQNPSCLKQFLDHHGLSLLWIFMVELSEAKGNSANN
IKLQLEIMKTLAVLPISTKNMLEESRVLTFIQRWAQTKTLPHPAEMDGYSSENTSRAQTP
LNTPDGSSTKLGPELDGDTSKPAVYRRLKIISENSLDSALSDASKASDGKEEEDDDDDEE
EDESSHAGLPEGKQTKADPVCETADPMKDAIEESGKEVKEEKLEEAGMSSSSQDQDQTEE
VKDKMELDLEKKDVEMKEDSSESPKDELEESKETSEEQESMEEHNSLAVTEKAELESDQP
AVKVLEPENQPIQTDVADLSPEQPSEQMEVQAETQEAEKSPLGSEVQPGESNTEAPPSSE
IPEASMPSEVTAAPADPSLIGTPSQDEEEGVSDVESERSQEPQVTALDISGMAARLLESW
KDLKEVYRIPKKSQVEKEANDRSRDRETALTPRTASGSREREREREKERERDRDRDYDRD
RDRDWDRDRDRDRDRDRDRDRDRVSDKTPRPERRRRRSVSPPSSYERSSRRTEERFDPSN
SNKTPRGVGGKERNKLSTEERRKLFEQEVAQREAQKQQQLQQQQQQQLQTMAYDPAMAYA
SSPGFITYPPGYPIQTFVDPSNPNAGKVLLPTPSVEPTLNYEQTPPQRLISDLGLPSPSS
TSQAAPVSSLSQHITTTNLTTGNPQQYAQPTVATQDAGVAVLSVPAQTAPQVQSQQSYTT
LWDPTTQQAVTVQTQPAQQYATAPAQAQTQTAIYYQGQPCQTIYSIPTAYPQANTPVIQA
YTEPTASYLHGQPVYPGHQQGVVVQQGSTVTTIVTSQTVQQEMIVPNNVIDLPPPSPPKP
KTIVLPPNWKVARDPEGKIYYYHVVTRQTQWDPPTWEGSSDNTSVDHESEMDLGTPTYDE
NPSKFSTKTAEADTSSELAKKSKETFRKEMSQFIVQCLNPYRKPDCKLGRISNTEDFKHL
ARKLTHGVMNKELKACKNPEDLECNENVKHKTKEYIKKYMQRFGSVYRPKEDTEVY
NT seq 7911 nt NT seq  +upstreamnt  +downstreamnt
atgggggaaccttgtgaccttaagcacttcgtaaaagaggaggggagtggtgcctcagtc
aaggttgagggcctatctaaggcagctctaatcaaaagcctgtctcccagagtgatgctg
tccaaccatttcttgcataaagggaccaagacgaaggtcaacctggaggatcagagtcgt
cagaaagtgtccttcagcttcgcacagaccaagaagccactgcagagcctgttcttcatc
cctgccagccctgaaaagtctgtcgctgaacctcaggctgcctcgtcacagtcaacctca
gacaaaggagggcagagtacagacagcaaaactgaacagacgcccatggtgccaacatca
atagcagagacaccttctcaaacagtctcttcagccactaaaccgaaaccggacctagca
aagattcacttcaaaaagcaaattctcagtgtttctgtcactgaagagaaaccaacatct
gttatgccagaggagcagctctcctctgaattgcaggttttgcagaaatcaacaagtaat
agtgcaactgaattcccaacaccccagcctcagaatgttgtcagtgtctgcccgtctgag
aatgctcacatcgaaacctctgagacaagggtaaccccaagcctcaagaagccagttgct
tcctcaggaaaagatggcgagacttccagcagtacagagcaggataataaggtatacaaa
aggaaaacccggtcccactctgatagtgctcctcctggctcagaatctgatggagattct
gtccatatttcttccattcgcaaatcagttgactccaaaagtaaaacaaacactgacagc
agaagtaaagaggtaaaaaagtcttcctctagttcacatttggaggaaaaggaaaaaagt
tcttctaagcggtcagagaatcatgaaaggtcttctagttactccaaatcagaacgcgat
tctagacacacatcatcacgctcggctcgatcagacaaggattatagaaggtccaggtca
agatcacggtctcgatcaagagcatctcgaaccagttcctctcattctaggtcagagagg
tccagaggtgacagaggatcgcgctctgaaaggtcatattaccatgattctgaccggaga
tcacacaggagttctccacgcagagagagaagacgttctcgctctcgcactgacagaact
cgggatagttctgattctgaggatgaccataggaagacacggacaaggacaagtgattcc
agtagatcgtctgtccatccaagctcacataaagagtcaaaatcatcttactcaaaatct
gagaaagtctctaaatctgtagattcccctcactctttagagttcgataaaagaacacaa
tcatcaaagtctgaaaggacttcaaaacgattatcagactctgattcgcagcgcaagtgc
tctcctgatctgaactccagttaccgtaaatctagtacgcatcacaagtctgagaccaac
agcaaatcctcttcttccagtatgcatacccattctcaaacatatgaaaaatgccaaaaa
agcagctccagtgactctgaggcagatcataagggaaaatcacagggctctgacaaaagc
tctggctcggaggagaggagtaaagactcctttaagaaaaccagtaggccggactccaaa
cagatgaccccctctagatcgtctgtgaaaaccactggacatgatagacaatcagatgac
atgttttacagctccagcaaagcaccgtcatgtgcaaccaccacagaactttgttcttgg
agtgaaaaattaaaatctgattcccatcaagatggaaatgaggatgttgaggagatggtt
tcatggactgaaaagggtttgcaagaatcactgtccaaaagagcaaaagaaactaagtca
ggtcttgaagttgagaataaaaatacctccgctataacctcaagtgaaagcctaaagcat
gtaaatgtcgccctggaaaacttgaccaatgtgaaggatagcctttcttctgataatcga
ccacatatgaattcaaatgcagctgtcttaaattcaagcagtagtaatgacagtatggtg
tccagcctggacaagaaagtcagtgatcattcaccacggccaaagtctggacctgatgca
gcagatacatctgtcacacatgatatccggcagaacactaaaccagaaattgttgagctg
aatgaagtcgataagcagtctgacacaagtgtgccgctcaaattggagtcatcgtgtatt
gaatctgagaaccagcggtcatgtgggcagcaaagtatggatactgttaaaaagagctgc
agtactaccaaaaagtcccggtgggatattgttgggcaggatgcctcagagagtgataat
tcacagaggacactcagtacagagagcaagcctactgtgaaaaaagtgatctctgtcaaa
aaaatagagttttctaaagacaatatccaacaagactctgatattaaagataatattgaa
caagaagctgaaacacattccacactggtaaagcagactgagatctctaagcaggagttc
ggctcagatagcacatccatgatcgataaatgcaaagaccaaagtgagccttcacaagca
agcaccagcattgaccactgtgacttaaaactgactgtttctcaaaaagcaaacacggat
gagccgttgcacataaatgatacattgcaggttgatacagctgcaaagcttaagagctgg
aatgaaggtgatcacgatgaaaaatcaaaggacagcgatcacaaaagcaaactgagtaag
agcacatcgcttcatcaggatgcatttggaggacagagtgaggccagtgatagtgacaac
tcggagtatgactccgattgcggcgaggctataaaacgattgcactctgtggtggtggtg
ccaaagaattcttccctaacaatggatacacaggacaagggagcttcctgcagtcctatg
aatatttcagaactgcacaatgctaatatagcagctgacatgagtacctatgatgtccca
aatcaagtcagctctcagcaaaggcaggggagtcctttcattgcatttggggagaccatt
ggtccatgtgctggtgcaaatgatgcatccaatagcggtatgttgtgtcagtcccagagc
aatatgattgatagcaccagtcactctgagggttccagttctgtcagtgctctgccttac
atggctagtcatgtcagtgcccatagaagtgccacagatcctgccaacagccttgataat
tccagacagtgtgagcaagggcagcataccacaagcagcagagatgagcggatgtatccc
caataccaacctaacaatttctcaaattctgacaatatcagtgacaaacatggattcacc
ataggttgggatttttcgcaaccagagcagccaagtagtacataccagcagcctgatagc
agtcatgggccacagttaccaaacactaaactgatgggaacctctcccaaggggcaggag
cacaggcacagtaatgcttcctggaaccatcaatccccaaacatgcagactagcagaaaa
acctacctccatgcacatgaacattatcaggattctgcaggtgaaatccatcccgattct
ctaactaatgaccacgaagactacagtggggataaaaatattagcaaaacagctcttgaa
tggagtggacctaacactccagggtcatcaagctttgtacaaggtcatgaaataagcagc
aacagccggggctctgctgtgcctgacccccctagagaagacagttttagaccccacaga
agcaggggccctcccaagaaaaggcgaccagagattgagtcagattcagacaatgaggca
gaggctgggccagcaggcaaaagggagcgtcaaggagatacttatgtctctaaggaaaat
cttgtcaaagctgaggtgcaccgtccatcacttaatctgcaggacttccaagacgccaat
aaatggaaagatctggccaagtctaaaaagatgcccccttactttgacttgattgaggaa
aacctctacttaactgaaagaaagaagagcaaatctcatcgagatatcaagaggatgcag
tgtgagtgccctgtgctgcccagagaggagcgctcaaggggagtattagcatgcggggaa
gattgtttaaaccggctgctgatgattgagtgctcatcacggtgcctgaatggagtctac
tgctctaatagacgctttcagatgaaacaacatgcagactttgaggttatcctcacagaa
gacaaaggctggggactacgagcagctaaagacttggctccaaacacctttgtattggaa
tactgtggggaggtgttggaccacaaggagttcaaaacaagagtgaaagaatatgctcgg
aataagaacatccattactacttcatgtctctaaaaaataatgagatcattgatgcaacg
ctgaagggtaattgctctcggtttatgaaccatagctgtgagcccaactgtgagactcaa
aagtggactgtcaatggccagcttagagttgggttcttcaccaccaaggctgtcactgca
ggaactgaactgacatttgattaccagttccagagatacggcaaagaagcacagaaatgc
ttctgtggtgcacccagctgcagaggcttcctgggtggagagaacagagtcagtgttcga
gcagctggagggaggatgaagaaagaccgcagtcgaaagagtgctctcactacggttgat
gaggaactggaggcattattggagaatggagaaggcctgtatgatgagaaacaggtggtg
tctctctgcagactaatggttcgagtggaaaccatggagcagaaactcatctgtctcaag
ctcatacaagatactcaaaatccatcatgcctgaagcagttcctggatcatcatggattg
tctttgctgtggatcttcatggtggagctttctgaagctaaaggcaacagtgccaataac
attaaactgcagctagagattatgaagaccctggctgtgctgcccatctcaactaagaac
atgttggaagagagcagagtcctgaccttcattcagcgatgggcccaaacaaaaacactc
cctcaccctgctgagatggacggctactccagtgagaacacctcccgtgctcagacacca
ctcaacactcctgatggttcctcgaccaaactgggaccagaattggatggtgacacctcc
aaacctgctgtgtaccgtcgccttaaaatcatcagtgaaaacagtctggacagtgcactc
tctgacgctagcaaagcatctgatgggaaggaggaggaggacgatgacgatgatgaggaa
gaagacgaatcctcgcatgcaggactccctgagggcaaacagacgaaggcagacccagtg
tgtgaaactgcagatccaatgaaagatgcaatagaagagtcagggaaagaggtcaaagag
gagaaactggaagaggcaggcatgagttcaagcagtcaggaccaagaccaaacagaggag
gtgaaagacaaaatggagttggatttggagaagaaggatgttgagatgaaagaggactca
agtgagagtcctaaagatgaactcgaggagtcaaaggagactagtgaggagcaggagagt
atggaggagcacaacagtctggcagtgacagaaaaggctgaactggaaagtgaccagcct
gctgttaaagtccttgagccagagaatcagcccattcaaacagatgttgctgatctgtct
cctgagcagccttcagagcagatggaagtccaggcagagacacaagaggctgagaaatct
cctcttggcagcgaggtgcaacctggtgaatctaacactgaagctcccccaagctctgag
atcccagaagccagtatgccctctgaggtcacagcagcccctgcagacccatcactgata
ggaactccttctcaggatgaagaggaaggagtctcagatgtggaaagtgagaggagccag
gagccccaggtcactgctttggacattagtggcatggctgcaaggctacttgaaagctgg
aaagatctgaaggaggtgtacagaataccaaagaagagtcaggtggaaaaggaagcaaat
gatcgcagccgagatcgagagaccgctttgacaccacgcaccgcttctggtagccgagaa
cgtgaaagggagcgagagaaggagagggaacgcgacagagacagagattatgacagagac
agagatcgagactgggacagggacagggacagggacagagacagagatcgtgatcgagac
cgtgatcgagtctctgacaaaacaccacgccctgagagacggaggagacgctctgtgtca
ccaccctcatcctacgaaaggagcagccgacgcacagaggaacggtttgacccatctaac
agtaacaagacaccaaggggagttggtggcaaggagcgcaacaagttgtccacagaggaa
cgcagaaagctgtttgagcaggaggttgctcagcgggaggcacagaaacaacagcagctt
caacagcagcagcagcagcagcttcaaactatggcttatgaccctgcgatggcctatgct
tccagccctggcttcatcacctacccccctggatatcccatccagacctttgttgatccc
tccaaccccaatgcaggcaaagtactgctcccaaccccttcagttgaacccactcttaac
tatgaacagactcctcctcagcgtctcatctcagacctgggacttccctctccatcctcc
acttcccaagccgctccagtctctagtctctctcagcatatcaccaccaccaacctcacc
actggaaacccccagcagtatgcccagccaactgtagcaacccaggacgcaggtgtagct
gtgctttctgtaccggcccagacggcccctcaggtacagagccagcagagctacaccact
ctctgggaccccaccactcagcaggctgtgactgtgcagacccagcctgcacagcagtat
gccacagctccagcgcaggcccagacacagacagctatctattaccagggccagccatgc
caaaccatctacagtatccccaccgcctaccctcaggctaacactccagtcatacaggca
tacactgaacccacagccagctacctgcatggccagccagtgtatcctggccatcaacag
ggagtggtggtgcagcagggaagcacagtcaccaccattgtcacatcccagactgtgcaa
caggaaatgattgtacccaacaatgtgatcgacctgccacctccctcaccccccaaaccc
aaaaccatcgtcctacctcccaactggaaagtggctcgggaccctgagggcaagatctac
tactaccatgttgtcacaaggcaaacacagtgggaccctccaacctgggaaggaagtagc
gacaacactagcgtggaccatgaatctgagatggacctgggaactcctacttatgatgag
aatccttccaagttctctacaaaaacagctgaagctgacacttccagtgaactagctaaa
aagagtaaagagacatttcgcaaagagatgtcccagttcatcgtgcaatgtttaaatcct
tatcggaagccagactgcaaattgggacgcatcagcaacacggaagactttaaacaccta
gctagaaagctaactcacggagttatgaacaaggagctgaaagcttgcaagaatcctgag
gaccttgagtgtaacgagaatgtgaagcacaagaccaaggagtacatcaagaagtacatg
cagagattcggctccgtgtacaggccaaaggaagacacagaggtgtactag

DBGET integrated database retrieval system