KEGG   Lates calcarifer (barramundi perch): 108891921Help
Entry
108891921         CDS       T04895                                 

Gene name
zbtb16
Definition
(RefSeq) zinc finger and BTB domain-containing protein 16 isoform X1
  KO
K10055  zinc finger and BTB domain-containing protein 16
Organism
lcf  Lates calcarifer (barramundi perch)
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:lcf04121]
    108891921 (zbtb16)
Ubiquitin system [BR:lcf04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     108891921 (zbtb16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2_4 zf-C2H2 BTB zf-C2H2_6 zf-C2H2_jaz zf-met zf-C2H2_8 DZR zf-C2H2_11 MIX zf-C2H2_2 zinc_ribbon_15 zf_UBZ zf-MYST Zn-ribbon_8
Motif
Other DBs
NCBI-GeneID: 108891921
NCBI-ProteinID: XP_018544804
LinkDB All DBs
Position
Unknown
AA seq 664 aa AA seqDB search
MDLTKMGMIQLQNPNHPTALLQKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFE
ILFHRSSQHYTLDFLSPKTFQQILEYAYTATLQAKVEDLDDLLYAAEILEIEYLEEQCLK
ILETIQSSDENDVEVNVNDGSTEEDDERKGHNGAKNSKKHSMESPYLSGTQQVSTMSGMV
DQSPSVSTSFGVSTLSPTKAAVDSLMSIGQSLLQQGFGGEQLIHGNSHQLMTEIKTEMMQ
VDMGGNGHDSPQNMESSASSNGERSGEDRNRDGPGTPTRSSVITSARELHYTRDDGMGDH
QAEVSQMGLEAMAGMTEKHLASLYTLPVNHKSDAIMSMPASMASALPMSPALAMSMDFSA
YGGLLPQSFIQREFFSKLGELAVGMKPDGRNQHERCNVCGAELPDNEAVEQHRKMHSGMK
TYGCELCGKSFLDSLRLRMHLLSHSAGEKAIVCDQCGAQFQTEESLEAHRQIHTGSDMAI
FCLLCGKRFQTQTALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSHTAGDHPFECE
FCGSCFRDESTLKGHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEKPFECKLCHQ
RSRDYSAMIKHLRTHNGASPYQCTICLEYCPSLSAMQKHMKGHKPEDIPPDWRIEKTYLY
LCYV
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggatttaactaaaatgggtatgatccagctccagaaccccaaccaccccactgccttg
ctgcagaaggccaaccagatgcgtctggccgggactctgtgtgacgtggtcatcatggta
gacagccaggagttccatgctcaccggactgtgctagcctgcaccagcaaaatgtttgag
atcctcttccaccgcagcagccagcattacaccctggactttctttcaccaaagactttt
cagcaaattttggagtatgcttacactgccacgctacaggccaaggtggaggacttagat
gaccttctgtatgcagcagagatcctggaaattgagtatttggaagagcaatgcctcaag
atcttggaaacaatccagtcctcagatgagaatgatgtggaggtcaatgttaatgatggg
agcacagaggaggatgatgagcgcaaaggccacaatggagccaagaactctaaaaagcat
tccatggagagtccctatctgtcaggtacccagcaagtctccaccatgtctggcatggtg
gaccagagtccctcagtctccacctccttcggtgtctccaccctgagtcccaccaaagct
gctgtggacagcctgatgagcatcggccagtctctgctccagcagggctttggtggtgaa
caactcatccatggaaactcccaccaactgatgactgagatcaagactgaaatgatgcaa
gtggacatgggtggcaatgggcacgacagccctcagaacatggagtccagtgcctccagc
aatggagagcgaagtggggaggacaggaaccgagatggtcccggaacaccaaccaggagc
agtgtaatcaccagtgcccgcgagctgcattatacccgcgatgacggcatgggtgaccat
caggctgaagtcagccagatggggcttgaagcaatggctggaatgacagagaaacacctg
gcctccctgtacaccctacctgtcaatcataaatcagatgccatcatgtccatgccggca
tccatggcctctgctctccccatgtccccagccctggctatgtctatggacttcagtgcc
tacgggggactcctgcctcagagcttcatccagagagaattcttcagtaagctcggtgag
ctggcagtgggcatgaaaccagacggcaggaaccagcatgaacgttgtaatgtttgcggt
gcagagctgccagataacgaagctgtggagcagcacaggaagatgcacagcggaatgaag
acctacggctgtgaactgtgtgggaagagcttcctggacagcctccgtctacggatgcat
ttgctgtctcattcagctggtgagaaggccatagtttgtgaccagtgtggcgcccagttc
cagacagaggaatccctggaggctcaccgacagatccacaccgggtcggacatggccatc
ttttgcctgctttgtggtaagcgtttccagacccagacagcgttgcagcagcacatggag
gtccacgctggcgtccgcagctacatttgcagcgaatgcaaccggactttccccagccat
actgcactcaaacgtcacctacgctcacacacagcaggggaccacccatttgaatgcgag
ttctgcgggagctgcttccgtgatgagagcacactgaagggccacaagcgcatccacacc
ggggagaagccctatgaatgtaacggctgtgggaagaagttcagcctcaagcaccagctg
gaaacccactaccgtgtgcacacaggtgagaagccattcgagtgcaagctgtgccaccag
cgatccagggactactcggccatgatcaagcacctgcgcacccacaatggcgcctcgccc
taccaatgcaccatctgcctggagtactgccccagcctgtcagccatgcagaagcacatg
aaaggccacaagcctgaagacatccccccagactggcgcatagagaagacctacctatac
ctctgctatgtctga

DBGET integrated database retrieval system