KEGG   Lates calcarifer (barramundi perch): 108892807Help
Entry
108892807         CDS       T04895                                 

Definition
(RefSeq) procollagen-lysine,2-oxoglutarate 5-dioxygenase 3-like isoform X1
  KO
K13646  lysyl hydroxylase/galactosyltransferase/glucosyltransferase [EC:1.14.11.4 2.4.1.50 2.4.1.66]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00310  Lysine degradation
lcf00514  Other types of O-glycan biosynthesis
lcf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108892807
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    108892807
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:lcf01003]
    108892807
Enzymes [BR:lcf01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.4  procollagen-lysine 5-dioxygenase
     108892807
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     108892807
    2.4.1.66  procollagen glucosyltransferase
     108892807
Glycosyltransferases [BR:lcf01003]
 O-Glycan biosynthesis
  O-linked Gal type
   108892807
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2OG-FeII_Oxy 2OG-FeII_Oxy_3 Anp1
Motif
Other DBs
NCBI-GeneID: 108892807
NCBI-ProteinID: XP_018546048
UniProt: A0A4W6EE87
LinkDB All DBs
Position
Unknown
AA seq 733 aa AA seqDB search
MSSCRLLCLLALAFLQSSVSAEQRRLSPENLLVITAATEETDGFKRFMRTTREFNYTVKV
LGLGEEWKGGDVARTVGGGQKVRWLKKELLKHSEKKDMVIMFVDSYDVIFASGPEELLAK
FSRLGHRVVFSAEGFCWPDQRLAPKYPVVHTGKRYLNSGGFIGFAPDLSAMVQQWKYKDN
DDDQLFYTKIYLDKTQRTKFNMTLDHRSRIFQNLNGAVDEVVLKFERAKVRARNVAYDTL
PVVIHGNGPTKLQLNYLGNYVPTAWTYEDGCGICDDDLLFFSDVPDEDMPLVYIAVFIEH
ATPFMEEFLDRLTTLNYPTARIRLFIHNNVVYHERHIQRFWERHRSLFPDALLVGPEENL
QEAKARTMAVEACKKDPDCDYYFSIDSDVALTNPDTLRILIEENKSVIAPMLSKHGKLWS
NFWGALSPEGYYSRSEDYIEIVQGKRIGLWNVPYITQTYLIKGSVLRSKLAQVSLYVDED
MDPDMVFCRSIRDQGVFMFVSNRDEFGRLVASTNFNTSRLHPDMWQIFDNPVDWREKYIH
ENYSRIFEDEKNLVEQPCPDVYWFPAFSDKMCDQLVETMEDYGQWSGGTNKDERLAGGYE
NVPTVDIHMNQIGFEKEWLKFLKEYIVPVTEKLYPGYYPKAQAIMNFVVRYRPDEQPSLR
PHHDSSTFTINIALNRKNVDYEGGGCRFLRYNCKVESPRKGWSFMHPGRLTHYHEGLPTT
RGTRYIMVSFVDP
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcctgtcgtcttctctgcctgctggctctcgccttcctccagagctccgtgtcg
gccgaacagcggaggctctctccagagaatctcctggtgatcaccgcggcaacggaggag
acggacggcttcaaacgcttcatgaggacgacccgagagttcaactacaccgtgaaggtg
ctgggtctgggggaggagtggaaggggggggacgtggctcggacggtgggtggaggtcag
aaggtgagatggttgaagaaggagctgctcaaacactctgagaagaaggacatggtcatc
atgttcgtggacagttacgacgtgatctttgcgtcgggtcctgaggagctgctggccaag
ttctcccgtctgggtcacagagtggttttctcagccgaggggttctgctggcccgaccag
agactggcccccaaatatcccgtggtgcacactgggaaacgctacctcaactcaggaggg
ttcatcggcttcgctccggacctcagtgccatggtccagcagtggaaatacaaagacaac
gacgacgaccagcttttctacaccaagatctacctggacaagactcagaggaccaagttc
aacatgactctggaccatcgctcccggatcttccagaatctcaacggagccgtcgatgaa
gtggtcctgaagtttgagagggcgaaggtcagagcgaggaacgtcgcctacgacacgctt
cctgttgtcatccacggcaacggaccgaccaagctgcagctgaactacctgggtaactac
gtccccacagcgtggacctatgaggacggctgtgggatctgtgatgacgacctgctcttc
ttcagtgacgtccctgacgaggacatgcctctggtttacatcgccgtgttcatcgaacac
gccacgcccttcatggaggagttcctggaccgactgacgacgctcaactaccccacagcg
aggatccgcctcttcatccacaacaacgtcgtgtaccacgagcgtcacatccagaggttc
tgggagcggcacaggtctctgttccctgacgccctgctggtcggaccagaggagaacctg
caggaggccaaggccagaaccatggcagttgaggcgtgtaagaaggatccggactgtgat
tactacttcagcatcgactctgacgtggccctgacgaaccccgacaccctgaggatcctg
atcgaggagaacaagtcggtcattgctcccatgttgtccaaacacgggaagctgtggagt
aacttctggggagctctgagtcctgaaggatactactccaggtctgaggactacatcgag
atcgtccaggggaagaggattgggctgtggaatgtgccgtacatcactcagacctacctg
atcaaaggcagcgtgctgcggtccaaactggcccaggtgagcctgtacgtggacgaggac
atggaccctgacatggtgttctgcaggagcatcagagaccagggcgtcttcatgttcgtg
tccaaccgtgacgagttcggtcgtctggtggcgtcgaccaacttcaacacgtcccggctg
cacccggacatgtggcagatcttcgacaaccctgtggactggagggagaagtacatccat
gagaactactccaggatctttgaggatgagaagaacctggtggagcagccgtgtccggac
gtttactggttccctgctttctctgacaagatgtgcgatcagctggtggagaccatggag
gactacggccagtggtcaggaggaaccaacaaggacgagcgtctggccggtggctacgaa
aacgtcccgactgtggacatccacatgaaccagatcggcttcgagaaggagtggctcaaa
ttcctcaaagagtacatcgtccctgtcacagagaagctctaccccggatactaccccaag
gcccaggccatcatgaacttcgtggtgcgttaccgtcctgacgagcagccgtctctgcgg
ccgcatcacgactcctccaccttcaccatcaacatcgccctgaacaggaagaacgtggac
tacgagggcggaggctgccggttcctgcgctacaactgtaaggtggagtctcccaggaag
ggctggtccttcatgcacccgggccggctgacccactaccacgagggcctgcccaccacc
agagggaccagatacatcatggtgtccttcgtcgacccctga

DBGET integrated database retrieval system