KEGG   Lates calcarifer (barramundi perch): 108893486
Entry
108893486         CDS       T04895                                 

Gene name
fgf1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04010  MAPK signaling pathway
lcf04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108893486 (fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108893486 (fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lcf04052]
    108893486 (fgf1)
   00536 Glycosaminoglycan binding proteins [BR:lcf00536]
    108893486 (fgf1)
Cytokines and growth factors [BR:lcf04052]
 Growth factors
  Growth factors (RTK binding)
   108893486 (fgf1)
Glycosaminoglycan binding proteins [BR:lcf00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   108893486 (fgf1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 108893486
NCBI-ProteinID: XP_018547070
LinkDB
Position
Unknown
AA seq 201 aa
MKAALSSPSCFLSCLRHSPGDMNSEHGGSLSLQAQGRHAALSKPQTLCRMSEGDVTVLPF
GPASLDLSRQEQPTLTRLYSQNGGYHLRILPDGTVNGGRQENDPYDVLRLKAVSIGVVVI
KGEATGRYLAMNKNGRLYGSQALNDECYFLEKYEENHYNTYRSQKYSWYVALKRNGQPKA
GPDTHQGQKAVFFLPRPAGNM
NT seq 606 nt   +upstreamnt  +downstreamnt
atgaaggcagcgttgtcctccccttcctgttttctctcatgtctcagacacagtccaggt
gacatgaacagtgagcacggtggatctctatcattgcaggcacagggacgtcacgccgct
ttgtccaagcctcaaaccctctgcaggatgtctgagggagacgttacagtgctgccattt
ggacctgcgtctctggatctgtccaggcaggagcaaccgacactgaccaggctctacagc
cagaacggaggatatcacctgaggattttaccagatggaactgtgaatggcggaaggcag
gagaatgacccatatgacgtcctcaggctgaaggctgtgagtataggagtggtagtcatc
aagggtgaggcgacaggaaggtacctggccatgaacaaaaatggacgcctctatggatcg
caagcactgaatgatgagtgttacttcctggagaagtatgaagaaaaccactacaacacg
tatcgctctcagaagtacagctggtatgttgcgctgaagaggaacggccaacccaaagca
ggaccagacacccaccagggtcagaaagccgtctttttcctgccaaggcctgcaggcaac
atgtaa

DBGET integrated database retrieval system