KEGG   Lates calcarifer (barramundi perch): 108893878Help
Entry
108893878         CDS       T04895                                 

Gene name
rb1
Definition
(RefSeq) retinoblastoma-associated protein
  KO
K06618  retinoblastoma-associated protein
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04110  Cell cycle
lcf04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108893878 (rb1)
   04218 Cellular senescence
    108893878 (rb1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lcf01009]
    108893878 (rb1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lcf03000]
    108893878 (rb1)
Protein phosphatases and associated proteins [BR:lcf01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108893878 (rb1)
Transcription factors [BR:lcf03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    108893878 (rb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rb_C RB_A RB_B DUF3452
Motif
Other DBs
NCBI-GeneID: 108893878
NCBI-ProteinID: XP_018547834
UniProt: A0A4W6FUR4
LinkDB All DBs
Position
Unknown
AA seq 913 aa AA seqDB search
MPPKKRNSGTTQSKGLKPSTESAPPDKKESPELSLKKHRDKDAEFVTLCKSLHVTDLVCD
RAWTLWKNVQESMDEVTDSQKRLWGACLFVIETDMDVACFTLTQVLKAVSLNVKQFMALV
RKLDVNMDTISTKVNSALTRLEKKYDVTLALYQRFEKTCKKIFALVSDGKEREIMRSCWT
MFLLAKGRVLQMEDDLVISFQLLLCTLELFIKRCPPDLLQPLYKSAISKVQSPPTRASRR
NQSKAKSRPPEPEVDVQLLETLCKENECNAEEVKNVYQTSFSAFLDSLDLSRSQDFPQVN
DFDQQYEEHYLKSRDIDGRLFFDGDETVLVPKVEISQVERTPKKNLPDEDTALIPPQTPI
RAAMTSIQQLRGDLISTGDQPSTNLATYFKNCTVDPTQDVVKRLETLGQTFSQRFGQAVG
PRCVILGKQRFTLGVRLYYKVMEAMLESEEKRLSVQNFSKLLNDSTFHTSLLACALEVVM
ATYGESSFKAGGYSHGGGGGDTAETDVCFPWILDVFSLAAFDFYKVIESFIKADPTLSKD
IVKHLETCENLIMERIAWRTGSPLFELLKQEHEGGAAEQVETPASFSQPLQHNHTAADLY
LSPMRPGLRVLPHESTATASSQASSQAPAQPASQTPRHRKSNSLSLFYKKLYRLAYTRLK
MLCSYLLSSHPELEPIIWTLFQHTLQHEYELMRDRHLDQLMMSAMYAICKVKSVDLRFKT
IVTAYKNMPNTNQETFKHVLITEGHYDSIIVFYNQVFMQRLKTNILQYASTRPPTLSPIP
QIPRSPYKFPNSPLRVPGSNNVYISPLKSPRMSPGIMTPRTRMLVSIGESFGLSGRFQKI
NQMVNSSSCKRALDLGPSPKPLKRLRFDGDGQDEADGSKSGGDSTLIQKLAEMSSTRSRM
QEQKMKEEEAKKE
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgccacctaaaaagcgcaactctgggacgacacagagcaaaggtctgaagcccagtact
gaaagtgcccctccagacaagaaggagagtccagagttatctcttaaaaaacacagagac
aaggatgctgagtttgtgaccctgtgcaagagccttcacgtcacagacttggtgtgtgac
cgtgcctggaccctgtggaaaaatgttcaagagtccatggatgaagtcactgacagtcag
aaaaggctttggggtgcttgcctgtttgtgattgagacagacatggatgtcgcctgtttc
accttaactcaggttctgaaagcagtcagtctgaatgttaagcagtttatggcactggtg
aggaagttggatgtgaacatggatacaatcagcaccaaggtaaattcagcactgacgcga
ctggagaagaagtatgatgtgacactggctctctaccagaggtttgagaagacttgcaag
aaaatctttgctttggtttccgatgggaaggagagggagatcatgcggagctgctggaca
atgtttcttttggccaaaggaagggttttgcagatggaggatgacctggtcatatcattc
cagctgctgctttgtacgctggagttattcatcaagcgctgccctccagaccttctgcag
cctctttacaaatcagccatcagtaaagtccagagccccccaacacgagcgtctcgtcgt
aaccagagcaaagccaaatcccgacctcctgagccagaagtggatgtgcagcttctggaa
accttgtgcaaagagaatgaatgcaatgcagaagaggtgaagaatgtgtaccagaccagc
ttctctgctttcctggactcactggatctctctagatcccaagattttcctcaggtgaat
gactttgaccaacaatatgaagaacactacctcaagagcagagacattgatggacggctg
ttttttgatggagatgagactgttcttgtgcctaaagtcgaaatatcacaggtggagaga
acgccaaagaagaacctgccagatgaagacactgcactcatccctccacagactccaatc
agagctgccatgacctccattcagcagttgaggggcgatctcatctcgactggggaccag
ccatccactaatctggccacatatttcaaaaattgcactgtggacccaacgcaggatgtg
gtcaaacggttggagactctcggacagacgttcagccaaagatttggtcaggcagttggc
ccacgctgtgtaatacttggcaaacagagatttaccctcggtgtcagactatattacaaa
gtcatggaagcaatgttggaatcggaagagaagcgactgtctgtgcaaaatttcagtaaa
ctcctcaatgactccacattccacacatcactgttggcctgcgctttggaggtggtcatg
gcaacatatggagagagcagttttaaggctggaggatacagccatggaggtggtggtggt
gacacagctgagactgatgtgtgcttcccctggatactggatgtgttcagcctcgccgcc
ttcgatttttacaaagtcatcgagagcttcatcaaggctgaccccactctgagcaaagat
atcgtcaaacatctggagacgtgtgagaacctcatcatggagaggattgcatggaggacg
ggctccccgctgtttgaactgctgaaacaggagcatgagggtggagcggctgaacaggtg
gagaccccggccagtttcagccaaccactgcagcacaaccacactgcagctgatctgtat
ctgtcccccatgcgccctggtcttcgtgtcttgccccatgagtccacagccacagcctct
tctcaagcttcctctcaggctccggcccagcctgctagtcagactccacgacaccgaaag
tccaactctctcagtctcttctataaaaagttgtaccgcctggcctatacaaggctgaag
atgctctgctcctacctgctgtcctcccaccctgaactggagcccatcatatggacactc
ttccagcacactttgcagcacgagtatgagctgatgagagaccgccatctcgaccagttg
atgatgtcagccatgtatgccatatgtaaagtgaagagtgttgacctgcgcttcaagacc
attgtcacagcatacaagaacatgcccaacactaaccaggagacctttaagcatgtgttg
atcactgagggccactatgactccatcattgtcttctacaaccaagtgttcatgcagagg
ctgaaaaccaacatcctgcagtatgcatctaccaggccgcctaccctctctccaatccca
caaataccacgcagcccctacaagttccctaactcacctctgcgcgtgcctggcagcaac
aacgtgtacatctcccccctcaaaagcccacgcatgtccccgggtatcatgactcctcgc
accagaatgctggtatcgatcggtgaatcgtttgggctgtccggtcggttccagaagatc
aaccagatggtcaacagcagctcatgtaagagggctctggatcttggcccctctccaaag
cctctgaagagattgcgattcgatggtgatggacaggatgaagctgatggcagcaaatct
ggtggagattccacactgatacagaagcttgcagagatgagttccactcgcagtcgtatg
caggagcagaagatgaaggaagaggaagcaaaaaaagagtaa

DBGET integrated database retrieval system