KEGG   Lates calcarifer (barramundi perch): 108894067Help
Entry
108894067         CDS       T04895                                 

Gene name
tmprss2
Definition
(RefSeq) transmembrane protease serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
lcf  Lates calcarifer (barramundi perch)
Brite
Enzymes [BR:lcf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     108894067 (tmprss2)
Peptidases [BR:lcf01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   108894067 (tmprss2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR DUF1986 SRCR Trypsin_2 Ldl_recept_a DUF3724
Motif
Other DBs
NCBI-GeneID: 108894067
NCBI-ProteinID: XP_018548149
LinkDB All DBs
Position
Unknown
AA seq 478 aa AA seqDB search
MNNNQANGPIYDNVGFQHDEQRPPPYSSQPRVYPSLPQETPSYVASTINTHHTSTPGTAH
NTEQKKGIKKCHWKSILCLSLCVLLILAVISLLLWYFLYYQCLLGKSCRSGGKCLSPSQW
CDGVRDCSHGEDESQCFRLYGTNFILQSYSSDSQTWMPVCAENWDNSYGRAVCEQMGYMR
QDYVTYRQTSAGSLASEGYMKLKSGSNHDSHMQSQLTHSQSCSARAVTLHCIECGRSSAA
PSTRIVGGTAAVNGAWPWQVSLQIVGIGHVCGGSIISPYWILSAAHCFQEFSNPQQWRVY
SGDVSLVKMSYGKTVQKIISHDKYNRETSDNDIALLKLDTPLTFTTTVRPVCLPNVDVNL
SSEHQAWITGWGALRSSGPSPDKLNQAQVTIYSRETCNRPEVLNGAVTQTMICAGKLQGG
VDTCQGDSGGPLVVKKANVWWLAGDTSWGIGCAWRNKPGVYGNVTYFIDWIYGQMQNE
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaataataatcaggcaaatggtcccatctatgataatgtagggttccagcatgacgaa
caaagaccccctccatacagctcacagcccagggtatacccttccctcccacaagagacc
cccagctatgttgccagcaccatcaacacccaccacacctcaacacctggaacagcacat
aatacggaacaaaagaaaggaataaagaaatgtcactggaaatctatcctgtgtctatct
ctgtgtgtgcttcttatcctggcggtgatcagcctcttgctctggtacttcttgtattac
cagtgtttactgggaaaatcatgtagaagcggtgggaagtgtctgagtccctcacagtgg
tgtgatggtgtcagggactgttcacatggagaggatgaatctcagtgctttcgcctttat
gggaccaacttcatactgcagagttattcatcagacagccagacgtggatgcctgtatgt
gcagagaactgggacaacagctatgggagagctgtgtgtgagcagatgggctacatgagg
caggattacgtgacctacagacaaaccagtgcaggttctttggcctccgaaggatacatg
aagctgaagtctgggagtaaccatgactcacatatgcagtcacagctcactcacagccaa
agttgctcagccagagccgtcacacttcattgtattgaatgtggacggagttcagcagcc
cccagtactcgtattgtaggtggtacagcggctgtaaatggagcctggccgtggcaagtc
agtcttcagattgttggtattggacacgtttgtggaggctccattatcagcccttactgg
atcctgtctgctgcacactgcttccaagagttctccaatcctcaacaatggagggtatac
tctggtgacgtgagcttggtgaaaatgagctatggcaaaactgttcagaaaatcatcagt
catgacaaatataacagagaaactagtgacaatgatattgccctactaaagcttgacaca
cctctgacctttacaacaacagtgaggccagtgtgtctccccaacgttgacgtgaacctc
tcttctgagcatcaagcctggatcacaggatggggagccttgcgctcatctggaccatcc
cctgacaaactaaatcaggcccaggtgaccatttacagcagggagacctgtaacaggcct
gaggtgttaaatggagcagttactcagaccatgatctgtgccggcaaactgcagggagga
gtcgacacatgtcagggtgacagtggaggacccctggtggtcaagaaggcaaatgtatgg
tggctggcaggggacactagctggggaattggatgtgcttggaggaacaagccaggagtc
tatggcaatgtaacctactttattgactggatatatggacaaatgcagaatgaatga

DBGET integrated database retrieval system