KEGG   Lates calcarifer (barramundi perch): 108894073
Entry
108894073         CDS       T04895                                 

Gene name
kitlg
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04010  MAPK signaling pathway
lcf04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108894073 (kitlg)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    108894073 (kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lcf04052]
    108894073 (kitlg)
Cytokines and growth factors [BR:lcf04052]
 Growth factors
  Growth factors (RTK binding)
   108894073 (kitlg)
SSDB
Motif
Pfam: SCF Herpes_UL16 DASH_Dad4
Other DBs
NCBI-GeneID: 108894073
NCBI-ProteinID: XP_018548158
UniProt: A0A4W6C3S7
LinkDB
Position
Unknown
AA seq 267 aa
MKKSKIWIRVCVYLLLFITLGVHSSKFDVNPVTDDISRLSVLRQNIPKDYKIPVHYVPKE
EGGMCWVKLNVFYLEESLQDLAHKFGNISSNRKDISIFIQMLQELRLNMGSLEPIMYDFE
CHYREERWQTAQYFDFVKDFLLAAQSREDSDDCYPPPCPTTSYTGGYIKASSPSSSTGSG
CLTDCKEPPVHKPRFLPVVVERSLLSLLFIPLIALVFLLVWKVRSRRNEEDLEQNPGAGG
LFTGTEGTAPPLDEISEKNKLNVIETV
NT seq 804 nt   +upstreamnt  +downstreamnt
atgaagaagtcaaaaatttggatacgcgtctgtgtctatttactgctgttcatcacgctt
ggggtacattcaagtaaatttgacgtcaacccagtgacagatgacatctctagactctct
gttttgagacaaaatattcctaaagattacaaaattcctgtacattacgttccaaaagaa
gagggagggatgtgttgggtaaaattaaacgtcttctacctggaggagagtttacaagat
ttagcacataagtttggaaacatttcatccaacagaaaagatattagcatattcatccaa
atgctccaagaactgcggctcaacatggggtctttggagccgatcatgtatgattttgag
tgccactacagggaagagaggtggcagacagcacaatactttgactttgtcaaagacttt
cttttagctgcacagagtagagaagattcagatgactgttatcctcctccctgtcccacc
acatcgtacacaggaggatatataaaagcatcgtccccgtccagcagtacaggctcaggt
tgtctgacagactgcaaggaacccccagtacataaaccaagattcctgcctgtggtggtg
gagcgaagcctgctctccttactgttcattccactcatagccctcgtattcctgcttgtg
tggaaggtccgatcacgaaggaacgaggaggatcttgaacagaatcctggagcaggtgga
ctcttcacaggaacagaagggactgcacctccattagatgaaatatcagaaaaaaacaag
ttgaacgtcattgaaacggtgtaa

DBGET integrated database retrieval system