KEGG   Lates calcarifer (barramundi perch): 108896045Help
Entry
108896045         CDS       T04895                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: hexokinase-2-like
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00010  Glycolysis / Gluconeogenesis
lcf00051  Fructose and mannose metabolism
lcf00052  Galactose metabolism
lcf00500  Starch and sucrose metabolism
lcf00520  Amino sugar and nucleotide sugar metabolism
lcf00524  Neomycin, kanamycin and gentamicin biosynthesis
lcf01100  Metabolic pathways
lcf01200  Carbon metabolism
lcf04910  Insulin signaling pathway
Module
lcf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lcf_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108896045
   00051 Fructose and mannose metabolism
    108896045
   00052 Galactose metabolism
    108896045
   00500 Starch and sucrose metabolism
    108896045
   00520 Amino sugar and nucleotide sugar metabolism
    108896045
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    108896045
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    108896045
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lcf04131]
    108896045
Enzymes [BR:lcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     108896045
Membrane trafficking [BR:lcf04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    108896045
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 108896045
NCBI-ProteinID: XP_018550581
LinkDB All DBs
Position
Unknown
AA seq 931 aa AA seqDB search
MSNVEANSQNITQLSKKAKMSGETSHLHLDGIPSDRLSQVQKYLEPFHLSLEKLQEISAR
LKKDMIRGLGKHTHNKAAVKMLPTFVRATPDGTESGDFLALDLGGTNFRVLHVRVVEEEQ
KVLKMDSQICAIPQEIMLGTGQQLFDHIAACLGDFLDAQNLKGQTLPLGFTFSFPCEQKE
IDKSILIRWTKGFNCSGVEGKDVVKLLKEAIQRRGDYDIGSVAMVNDTVGTMMSCGYRDQ
SCEIGMIIGTGTNACYMEEMKNVKRVEGEDGRMCINTEWGGFGDDGSLSDILTEFDVQVD
KMSINPGVHTFEKMISGMYLGEIVRLLLVKLTEDKLLFNGQTSEALRTPGKFQTKFISEI
EEKDNGLENGKKILTELGLKWDLVDVRVVRLVCDNISSRSARLCGAALATIANRIRTNHG
LDHLKTTVGVDGTVYRKHPNFSEELQATVRLLAPECSITFLVSEDGSGKGAAMVTAVAQR
LALQQRCRVKYLKPFDLSPNKLRGISAWLWTDMIRGLNKRTHNKAAVKMLPTFVRATPDG
TESGDFLALDLGGTNFRVLHVRVVEEEQKVLKVSQHAIPKKIMLGTGQQLFDHIAACLGD
FLDAQNLKGQALPLGFTFSFPCEQKEIDKGILIRWTKGFKCSGVEGEDVVKLLREAIQKR
GDYDIGSVAMVNDTVGTMMSCGYRDQSCEIGMIIGTGTNACYMEEMKNVKRVEGDDGRMC
INTEWGGFGDNGSLRNILTEFDVQVDKMSINPGVHTFEKMISGMYLGEIVRLLLVKLTED
KLLFNGQTSEALRTPGKFQTKFISEIEEEDNGLENGKKILTKLGLKWDPVDVRVVRLVCN
KISSRSAHLCGAALATIANRIRTYRRLDHLKTTVGVDGTVYSEHPNFREELQATVRRLAP
ECSITFQESKDGSGKGAAMAAAVAQRLSGGQ
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgtcgaggcaaacagtcagaacatcacacagctttccaagaaggctaaaatg
agcggagaaacctcacacctgcacctggacggcatcccttcggacaggctcagtcaggtg
cagaagtacctggagcctttccacctgtctctggagaagctacaggagatttctgctcgg
ctgaagaaggatatgattcgaggtttggggaaacacacgcataacaaggcagccgtgaag
atgctgcccaccttcgtcagggccacgcccgatgggacggagagtggcgacttcctggcg
ttggatctcggtggaacgaacttccgtgtccttcacgtccgtgtggtggaggaggagcag
aaagtgctgaagatggacagtcagatctgtgccatcccacaggaaatcatgctgggaact
ggacaacagctgttcgaccacatcgcagcctgtctcggtgacttcctcgacgctcagaat
ctgaagggacaaacccttcctctgggcttcaccttctccttcccctgtgaacagaaagaa
atcgacaagagcatcctgatccgctggaccaaaggcttcaactgctccggagtggaggga
aaagacgtcgtgaagctgctgaaagaagcgattcaaaggagaggggactatgatataggc
tcggttgccatggtgaacgacactgtgggcacaatgatgagctgtggctacagggaccag
agctgtgagatcggcatgatcattggtacgggaaccaatgcttgctacatggaggagatg
aagaacgtgaagcgggtggagggcgaggacggacggatgtgcatcaacacggagtggggc
ggcttcggagacgacggctccctgagcgacatcctgacggagtttgacgtgcaggtggac
aagatgtccatcaaccctggtgtccacacctttgagaaaatgatcagcggtatgtatttg
ggggaaattgttcgactgctgttggtgaagctaacggaggacaagctgctgtttaacgga
cagacgtcggaggcgctgaggaccccgggcaaattccagacgaagttcatctctgagatc
gaagagaaggacaacggtctggaaaatggcaagaaaattctgaccgagttgggcctgaaa
tgggatcttgtcgacgtccgggtggtgcgtctggtctgcgacaacatctcatcgcgctct
gcccgtctctgcggcgctgccctggcgaccatcgccaaccgtatccgtaccaaccacggg
ctggaccacctgaagaccaccgtgggggtggacggaacagtctacaggaaacaccccaat
ttcagtgaggagctccaggcgacggtacgcctcctcgcccccgaatgtagcatcaccttc
ctggtctcagaggacggcagtgggaagggcgctgccatggtaacagccgtggctcagcgg
ctggcgctccaacagaggtgcagagttaagtacctgaagcctttcgacctgtctcccaac
aagctgcgggggatttctgcttggctgtggacggatatgattcgaggtttaaataaacgc
acacataacaaggcggccgtgaagatgctgcccaccttcgtcagagccacacccgatggg
acggagagtggtgacttcctggcgttagatctcggtggaacaaacttccgtgtccttcac
gtccgtgtggtggaggaggagcagaaagtgctgaaggtcagtcagcatgccatcccaaag
aaaatcatgctgggaactggacaacagctgttcgaccacatcgcagcctgtctcggtgac
ttcctcgacgctcagaatctgaagggacaagcccttcctctgggcttcaccttctccttc
ccctgtgaacagaaagaaatcgacaagggcatcctgatccgctggaccaaaggctttaag
tgctccggcgtggagggagaagacgttgtgaagctgctgagagaagcgattcaaaagaga
ggggactatgatataggctcggttgccatggtgaacgacactgtgggcacaatgatgagc
tgtggctacagggaccagagctgtgagatcggcatgatcattggtacgggaaccaatgct
tgctacatggaggagatgaagaacgtgaagcgggtggagggcgacgacggacggatgtgc
atcaacacggagtggggcggcttcggagacaacggctccctgaggaacatcctgacggag
tttgacgtgcaggtggacaagatgtccatcaaccctggtgtccacacctttgagaaaatg
atcagcggtatgtatttgggggaaattgttcgactgctgttggtgaagctaacggaggac
aagctgctgtttaacggacagacgtcggaagcgctgaggaccccgggcaaattccagacg
aagttcatctctgagatcgaagaggaggacaacggtctggaaaatggcaagaaaattctg
accaagttgggcctgaaatgggatcctgttgacgtccgggtggtgcgtctggtctgcaac
aagatctcatcgcgctctgcccatctctgcggcgctgccctggcgaccatcgccaaccgt
atccgtacctaccgcaggctggaccacctgaagaccaccgtgggggtggacggaacagtc
tacagtgaacaccccaatttccgtgaggagctccaggcgacggtgcgccgcctcgccccc
gaatgtagcatcaccttccaggaatcaaaggatggcagtgggaagggcgctgccatggca
gcggctgtggctcagcggctgtcaggaggacagtga

DBGET integrated database retrieval system