KEGG   Lates calcarifer (barramundi perch): 108896773Help
Entry
108896773         CDS       T04895                                 

Gene name
ptgs2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00590  Arachidonic acid metabolism
lcf01100  Metabolic pathways
lcf04370  VEGF signaling pathway
lcf04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    108896773 (ptgs2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    108896773 (ptgs2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108896773 (ptgs2)
Enzymes [BR:lcf01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     108896773 (ptgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase hEGF EGF
Motif
Other DBs
NCBI-GeneID: 108896773
NCBI-ProteinID: XP_018551532
LinkDB All DBs
Position
Unknown
AA seq 608 aa AA seqDB search
MNRLTFTVFLLALGFLVCEGGNPCCSEPCQNRGVCTALGPDNYECDCTRTGYYGQNCTTP
EFLTWLKVNLKPTPNAVHYLLTHFKGFWNIINNISFLRDAIMRYVLTSRSHLIDSPPTYN
SDYGYKSWEAYSNLSYYTRSLPPVPEDCPTPMGVVGKKELPDAKVLAEKLLMRRQFIPDP
QGTSLMFAFFAQHFTHQFFKSDMKKGPAFTQAKGHGVDLSHIYGDNLERQHKLRLFKDGK
LKYQIMDGEIYPPTVKEVGVDMHYPPHVPDSHRFAVGHEAFGLVPGLMMYATIWLREHNR
VCDVLKEVHPDWDDERLFQTTRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQRF
QYQNRIASEFNTLYHWHPLMPDSFHIEDTDYSYKQFVFNTSVVTEHGINNLVESFTKQIA
GRVAGGRNVPGAIMYVAIKSIENSREMRYQSLNSYRKRFNMKPYSSFEDLTGEKEMSAIL
EEMYGHVDAVELYPGLLVEKPRPNAIFGETMVEMGAPFSLKGLMGNPICSPEYWKPSTFG
GSVGFNIINTASLQKLVCNNVRGPCPVASFHVPNIKETGSMIINSSTSHSRGSDINPTVI
LKERTTEL
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgaacagactcacatttacagttttcctattggcactgggctttcttgtgtgcgaagga
ggtaacccatgctgctcagagccatgtcagaacaggggagtttgcacagcactcgggcca
gataattatgagtgtgactgcacgcgcaccggatattatggacaaaactgcacaacacct
gagttcctcacctggctcaaagtgaatctgaagccaactcccaacgccgtccactacctt
ctcacccacttcaagggtttctggaacatcatcaacaacatctcatttctccgggatgcc
atcatgagatacgtgctgacatcccgatcccacttgattgacagtcctccaacttacaat
tcggattatggttacaaaagctgggaagcgtattccaacctttcctactatacgcgcagc
ctcccccctgtgccagaggattgcccaacccccatgggagtagtaggtaaaaaggagctg
cctgatgctaaagttttggctgagaagctcctgatgaggcgacagtttatcccggaccca
cagggcaccagcctaatgtttgcattctttgcacagcatttcacccaccagttcttcaaa
tctgatatgaagaaaggacctgcttttacccaggctaaaggtcacggggtggacctcagc
cacatttatggagacaacctggagaggcaacacaagctcagactcttcaaggacggaaag
cttaaatatcagatcatggatggggagatataccccccaacagtaaaggaagtgggtgtc
gacatgcactaccctcctcatgttcccgactctcaccgctttgctgtgggccacgaggcc
tttggcctggtccctggtctgatgatgtacgccaccatttggctgcgggagcacaaccgg
gtgtgtgatgtgctgaaggaggtgcaccccgactgggatgatgaaagactcttccagacc
acacggctcatcctgattggtgagaccataaagattgtaattgaggactacgtgcagcac
ctgagcggctaccacttcaagctcaagtttgaccccgagctgctcttcaaccagcgtttc
cagtaccagaaccgcattgcctcagagttcaacaccctgtaccactggcacccgctgatg
cctgatagtttccacattgaggatacagattacagctacaaacagtttgtcttcaacacc
tctgtagtgaccgagcatggcatcaacaacctcgtggagtcctttaccaagcagattgct
ggacgggttgctggtggtcgtaacgtccctggagctatcatgtacgtggccattaagtcc
attgagaacagcagagaaatgcgttaccagtctctgaattcctacaggaaacgattcaac
atgaagccctacagctcttttgaggacctgacaggagagaaagaaatgtccgcaatcctg
gaggagatgtacggacatgtggatgccgtggagctctacccaggcctgctggtggagaaa
cccagacccaacgccatcttcggagagaccatggtggagatgggggcccctttctccctc
aaaggcttaatgggaaaccccatctgctccccggagtactggaagcccagcaccttcgga
ggcagcgtgggcttcaacatcatcaataccgcctccctgcagaagctcgtctgcaataat
gtgcgtggcccctgtcctgtggcatcttttcatgtgcccaacatcaaagagacgggatcc
atgatcatcaactccagcacgtcccactcacgcggcagtgacatcaaccctacagtcatt
ttgaaagaaaggactactgagctctaa

DBGET integrated database retrieval system