KEGG   Lates calcarifer (barramundi perch): 108897888Help
Entry
108897888         CDS       T04895                                 

Gene name
enpep
Definition
(RefSeq) glutamyl aminopeptidase
  KO
K11141  glutamyl aminopeptidase [EC:3.4.11.7]
Organism
lcf  Lates calcarifer (barramundi perch)
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lcf01002]
    108897888 (enpep)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lcf04147]
    108897888 (enpep)
   04090 CD molecules [BR:lcf04090]
    108897888 (enpep)
Enzymes [BR:lcf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.7  glutamyl aminopeptidase
     108897888 (enpep)
Peptidases and inhibitors [BR:lcf01002]
 Metallo peptidases
  Family M1
   108897888 (enpep)
Exosome [BR:lcf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108897888 (enpep)
CD molecules [BR:lcf04090]
 Proteins
  108897888 (enpep)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N DUF1570 DUF5022
Motif
Other DBs
NCBI-GeneID: 108897888
NCBI-ProteinID: XP_018553205
UniProt: A0A4W6BS98
LinkDB All DBs
Position
Unknown
AA seq 954 aa AA seqDB search
MVDNMDLEKQQKRYCIRGKHVVIICVTVVVCCLAVGLGVGLSRPATPTPTPTAEPTQPPP
PERGPCMPSTDSSGDWRNFRLPSYVNPIHYDLALEPDLVQDTYTGTVDIHVEVSKPTRHL
WLHIRETFVSAMPRLKRLNSQGAQTEVTVKSCFEYKLQQYVVVEATEELPVTGPGEVYVL
SLDFQGWLNGSVVGFYRVIYTELGVTRKIAATDHEPTDARKSFPCFDEPNKKATYKISIT
HDATYDALSNMPVEGAPQQLPGNKVKTSFQKSVPMSTYLVCFAVHQFGYVERTSARGIPL
RIYAQKSQLGTAKYAADTTKIIFDYFEEYFNMTYSISKLDKIAIPDFGTGAMENWGLITY
RETNLLYDESQSSSYNKQRVASVIAHELVHQWFGNIVTMDWWDDLWLNEGFASFFEYVGV
EKAEPTWGMRDIMIISDVLPVMVDDALLSSHPIIVNVSTPAEITSVFDAISYSKGASILR
MLEDWMGKDMFRDGCRKYLKDYYFKNAKTANFWTSLASVSGLPVAEVMDTWTNQMGYPVL
DLSVSETNAKLSQERFLLDPKADANQPPSPLGYKWTIPVKWHSVKSDKNMLAMFNKSSTE
HVISNYSLSEDGLLKVNNDHIGFYRVNHDDHMWNTISQQLQNNHREFDAADRTSYIDDVF
ALARADIIDYGNAFNLTMYLTNETDYIVWDRVASSIAYVRDMLSGDAALYKRFQKLFRDH
VKAISTQLGWNDEGTQIQRLLRETVLSISCQMGDQEALNEASHIFDQWINGSLSSVAVNL
RLLVYRYGMKNSGTEEKWNIMFQRYRDTSLAQEKDKLLYGLASVENVELLYKLLEATKNE
SIIRSQDLFTVVRYVSYNPLGQTIAWDWTTLNWDYLVNRYTINDRNLGRLLNRITTTYNT
ELQLWKMEHFFRLTPNAGAGEMPRQQALETVRNNIEWIRRNENEIRGWLENNVA
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atggttgacaacatggacttggagaagcagcaaaagcgttactgcatccgtggtaagcat
gtagtcatcatatgtgtgacggtggtggtttgctgtttggcggtgggccttggggtgggc
ctctccaggccagccacccccacccccacccccacagcagagcctacccagccccctcca
cctgagagagggccttgcatgccttccactgactctagtggggactggaggaatttccgt
ctgcctagctatgtgaacccaatccactatgacctggctctggagccagacctggtccag
gacacctacacgggcactgtggacatccatgtggaagtcagcaagcccacccgccatcta
tggctccacatcagggagacgtttgtcagcgccatgcccaggctgaagaggctgaacagc
caaggggcccagacggaggtgacggtgaaaagctgttttgaatacaaacttcagcagtat
gtggtggtggaggccacagaggagctgcctgtcaccggcccaggagaagtgtatgtgctc
agcctggacttccagggctggctcaacggctccgtggtgggattctacagggtcatctac
accgagctgggggtcaccagaaagattgctgcaactgatcatgaaccaacagatgcccgc
aagtcatttccctgctttgatgaacccaacaagaaggccacgtacaagatctctatcact
cacgatgctacctatgatgctctgtccaacatgccggtggagggtgcccctcaacaactg
cccggcaataaagtgaaaacctccttccagaagtctgttccaatgagcacctatttggta
tgttttgctgtacaccagtttggttatgtggaaagaacttctgctcgagggatccctttg
aggatctatgcccagaagagtcagttgggaactgcaaagtatgcagctgacacaactaag
atcatctttgattactttgaggagtatttcaacatgacatactccatctcaaaactggat
aagatagccatacctgactttggtactggtgctatggagaactggggcctcatcacctac
agggagaccaacctgctgtatgatgagagccagtcttcctcctacaataagcagcgagtg
gctagtgttattgcccacgagctggttcaccagtggtttgggaacattgtgaccatggac
tggtgggatgacctgtggcttaatgagggctttgccagtttctttgagtatgttggtgtg
gagaaagctgaacctacctggggcatgcgagacatcatgatcatcagtgatgtgcttccc
gtaatggtggacgacgccctcctctcctctcacccaatcattgtgaatgtgtcgacccca
gcagagatcacctctgtgtttgatgccatctcatacagcaagggagcgtccattctcagg
atgctggaggactggatgggtaaagatatgttcagagatggctgtcgaaaatatttgaaa
gactactacttcaagaatgccaaaacagccaacttctggacatctcttgccagtgtgagc
gggttgccagttgcagaggtaatggacacatggaccaatcagatgggttatcctgtgctg
gacctgtctgtttcagagacaaatgccaagctgagccaggagcgtttcctgctggatcct
aaagctgatgccaaccagcccccttcacctcttgggtacaagtggacaataccagtgaaa
tggcactctgtgaaaagtgacaagaatatgttggcaatgtttaacaagagcagcacagag
catgtcatcagtaactactcgctctcagaggacggtctgctgaaggttaacaacgatcac
attgggttctacagagtaaaccacgacgaccacatgtggaacactatcagtcagcagctt
cagaacaaccacagggagtttgatgcagctgatcgtacaagctacattgatgacgttttt
gctcttgcaagggcagacattatagattatggtaacgccttcaatcttacaatgtacctg
acaaatgagactgattacatagtctgggaccgtgtggcttcctctatcgcctatgttcgg
gacatgttgtcaggcgatgctgcactctacaaaaggtttcagaaactctttcgtgatcat
gttaaagcaatctcaacacaacttggatggaacgatgagggaacacagatacagaggtta
ctgagggagactgtgctcagtatttcctgtcagatgggagatcaggaggctctgaatgaa
gcctcccatatctttgaccagtggattaatggaagtctcagcagtgtggctgtgaacctg
aggctgctggtctatcgatatggcatgaagaactcaggcactgaggaaaaatggaacata
atgttccagaggtacagagacacttctttggctcaggagaaggacaagctgctgtacgga
ctggcctctgtggagaacgtcgaacttctatacaagctcctggaggccactaagaatgag
agtataattaggagtcaggatctgttcactgtggttcggtacgtctcctacaaccctctg
ggacagaccattgcctgggactggaccacactaaactgggactacctggtcaacaggtac
accatcaatgacaggaacctcggtcgtctgctcaatcgaatcaccaccacctacaacaca
gagctgcagctatggaagatggaacatttcttccgtctaacacctaatgctggtgccggg
gagatgccgaggcagcaggcactggagacagtgaggaacaacatcgaatggatcagaagg
aacgagaacgagatcagagggtggctggagaacaatgtggcctga

DBGET integrated database retrieval system