KEGG   Lates calcarifer (barramundi perch): 108899247
Entry
108899247         CDS       T04895                                 

Gene name
rassf1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
lcf  Lates calcarifer (barramundi perch)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2
Other DBs
NCBI-GeneID: 108899247
NCBI-ProteinID: XP_018555105
UniProt: A0A4W6CCG0
LinkDB
Position
Unknown
AA seq 365 aa
MSWGEFIELRDLRANTEQIELTGTRLPCSPPRLERTNALRISPGKVPDLLSRVGIIRVLS
STQDPQLLEGKGEGHNFQPCSHAQPTWCDLCGDFIWGLYKQSLRCVNCKFTCHYRCRALI
QLDCSWDRGSVSDQTCVVEHTIETDTNVDEQTECGKQELTTADIQQKVKEYNAQINSNLF
MNMNKDGSYTGFIKVQFKLARPVSVTPPKKGGHDAAGRKASGVKRRTSFYLPKDASKHLH
ISSRTSAREVIEALLKKFTVVDNPGKFALFERSERHDQVYVRKLSDDERPLRLRLCTGPS
EKVLSFVLKENETGEVNWHAFSMPELKNFLRILQREEEEHIKQIVQRYALARTKMQEALA
GSTPG
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgtcttggggggagttcatcgagcttcgtgacctgcgtgcgaacacggagcagatagag
ctgacgggcacacgtttgccctgctcaccccctcgcctggaaagaaccaacgccctgagg
atcagcccggggaaggtcccggacctgctgagccgggtcggcatcatcagagtcctgagc
agcacccaggacccccagctcctggaggggaagggagaaggacacaacttccaaccctgc
agccacgctcagcccacatggtgcgacctgtgcggagacttcatctggggcctttacaag
cagagcctgcggtgtgtcaattgtaaattcacatgccactaccgctgtcgtgccctgatc
cagttggactgcagctgggaccgaggctctgtgtccgaccagacatgcgttgtggagcac
accatagaaacagacacaaatgtggatgaacaaactgaatgtggcaagcaggagttgaca
actgcagacattcagcagaaggtgaaggaatacaacgctcagatcaacagcaatctgttc
atgaacatgaacaaagacggttcctacactggcttcataaaggtgcagttcaagttggcg
cgacctgtgtcggttacacctcctaagaaaggcggtcacgacgctgcagggaggaaggcc
agcggagtgaagcgtcgcacctctttctacctgccaaaggacgcatccaagcacctgcac
ataagctctcgcacttctgcccgggaggtcattgaagctttactgaaaaagttcactgtg
gtggacaatcctggcaagtttgctctgtttgagcgcagcgagcgtcatgaccaggtttat
gttcgtaagctgtctgatgatgagcgccccctccgtctgcgtctgtgtactggacccagt
gagaaagtcctcagttttgtgctcaaagaaaacgagactggagaagtcaattggcatgcc
ttctccatgcccgagttaaagaacttcctgcgcatcctgcagcgtgaagaagaggagcac
atcaagcagatagtgcagcgatacgctctggcccgcactaagatgcaggaggctctggca
ggctccacccccggctga

DBGET integrated database retrieval system