KEGG   Lates calcarifer (barramundi perch): 108899372Help
Entry
108899372         CDS       T04895                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: actin, cytoplasmic 2-like
  KO
K05692  actin beta/gamma 1
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04145  Phagosome
lcf04210  Apoptosis
lcf04510  Focal adhesion
lcf04520  Adherens junction
lcf04530  Tight junction
lcf04810  Regulation of actin cytoskeleton
lcf05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108899372
  09143 Cell growth and death
   04210 Apoptosis
    108899372
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108899372
   04520 Adherens junction
    108899372
   04530 Tight junction
    108899372
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108899372
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108899372
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:lcf03021]
    108899372
   03019 Messenger RNA biogenesis [BR:lcf03019]
    108899372
   03036 Chromosome and associated proteins [BR:lcf03036]
    108899372
   03029 Mitochondrial biogenesis [BR:lcf03029]
    108899372
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lcf04812]
    108899372
   04147 Exosome [BR:lcf04147]
    108899372
Transcription machinery [BR:lcf03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     108899372
Messenger RNA biogenesis [BR:lcf03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     108899372
Chromosome and associated proteins [BR:lcf03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     108899372
    NuA4 complex
     108899372
  Chromatin remodeling factors
   BAF complex
    108899372
   PBAF complex
    108899372
   SWR1 complex
    108899372
Mitochondrial biogenesis [BR:lcf03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    108899372
Cytoskeleton proteins [BR:lcf04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     108899372
Exosome [BR:lcf04147]
 Exosomal proteins
  Proteins found in most exosomes
   108899372
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 108899372
NCBI-ProteinID: XP_018555290
LinkDB All DBs
Position
Unknown
AA seq 375 aa AA seqDB search
MEDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSY
ELPDGQVITIGNERFRCPESLFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPTTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggaagacgaaattgccgccctcgttgttgacaacggatctggtatgtgcaaagctggc
tttgcaggagatgacgctccccgtgctgtgttcccctccattgttggacgtcccaggcat
cagggtgtgatggttggcatgggccagaaagacagctatgttggtgatgaggcacagagc
aaaaggggtatcctgaccctgaagtaccccattgagcacggcattgtcaccaactgggat
gacatggagaagatctggcatcacaccttctacaacgagctgagagttgcccctgaggag
cacccagtcctgctcacagaggcacccctgaaccccaaggccaacagggaaaagatgacc
cagatcatgtttgaaaccttcaacacccctgccatgtatgtggccatccaggctgtgctg
tccctgtacgcctctggtcgtaccactggtattgtcatggactctggtgatggtgtgacc
cacacagtgcccatctacgaaggctacgctctgccccacgccatcctcaggttggacctg
gctggcagggacctcacagactacctcatgaagatcctgaccgagaggggctacagcttc
accaccacagctgagcgtgagattgtgcgtgatattaaggagaagctgtgttacgttgca
ctggactttgagcaagaaatgggaactgctgcctcctcttcctccctggagaagagctac
gagctgcctgacggacaggtcatcaccatcggaaatgagaggttccgttgccctgagtcc
ctcttccagccctctttccttggtatggagtcttgtggtatccatgaaactaccttcaac
agcatcatgaagtgtgatgtggatatccgtaaggacctgtacgccaacactgtgctgtct
ggaggtaccaccatgtaccctggcattgctgaccgtatgcagaaggaaatcactgccctg
gcacccaccaccatgaagatcaagatcattgctcccccagagaggaagtactccgtatgg
atcggaggctccatcctggcctccctgtccaccttccagcaaatgtggatcagcaagcaa
gagtacgatgagtccggccccagcattgtccacaggaagtgcttctaa

DBGET integrated database retrieval system