KEGG   Lates calcarifer (barramundi perch): 108899625
Entry
108899625         CDS       T04895                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: NF-kappa-B essential modulator-like
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04010  MAPK signaling pathway
lcf04210  Apoptosis
lcf04620  Toll-like receptor signaling pathway
lcf04621  NOD-like receptor signaling pathway
lcf04622  RIG-I-like receptor signaling pathway
lcf04623  Cytosolic DNA-sensing pathway
lcf04625  C-type lectin receptor signaling pathway
lcf04920  Adipocytokine signaling pathway
lcf05132  Salmonella infection
lcf05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108899625
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108899625
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108899625
   04621 NOD-like receptor signaling pathway
    108899625
   04622 RIG-I-like receptor signaling pathway
    108899625
   04623 Cytosolic DNA-sensing pathway
    108899625
   04625 C-type lectin receptor signaling pathway
    108899625
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108899625
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108899625
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    108899625
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lcf01001]
    108899625
Protein kinases [BR:lcf01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   108899625
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10 HBS1_N Atg14
Other DBs
NCBI-GeneID: 108899625
NCBI-ProteinID: XP_018555688
LinkDB
Position
Unknown
AA seq 620 aa
MVQPQPDGPMQWDMSGEESGGALRVPPELAANEVVTRLLGDNQQLREALRRSNLALRQRC
EEMEGWQRRTREEREFLSSRFQEARALVERLAQENHSLKGLVNGPASSSNHCCSSSQTED
QQGRPVRNGPLDGPQTLDQRERKRVEETDQHTQTTPPRSLGDASVHSSLSSTLPTPPTSL
SEVLGELMGRENGQPVEGANEFLQLLKSHKEKLEEGMRELRRKNEELERDRDEGEKERER
MRRCIDQLRAKLAQAQASNVTEEVVQHRSEAQHSSDCSSLAKLTEQLQATQGRYRELEEK
LDYLQKSSAQRDRTEALLKQKDKDCAQMAKDCEALKAQATSLLGELNERQSCLEKSEHER
KILEEKLCSKLKALQAAERELEQQKKQHNVAMDKLLLQTQSLEQALKTERHVVTEEKKKL
TQLQHAYTCLFRDYDSKLKSEGGDLCGRLEEAERALALKQDLIDKLKEEVEQQKGSLETV
PVLTAQAEIYKADFLAEREAREKLNQKKEELQDQLNQAMAEIERIKQDAASRARMEQMKM
RHMEDFPPRAPLIPPPQGVFPSPAFNTVPPASSFRNQGLVPVGDQGAAGTEELPDLCCPK
CQYQAPDMDTLQIHVMDCIQ
NT seq 1863 nt   +upstreamnt  +downstreamnt
atggtgcagccccaacccgatggcccaatgcagtgggacatgtcaggagaggagagtgga
ggggccctcagggtcccaccagagctggctgccaatgaagtggtgaccaggttactgggt
gataaccagcagcttagagaggccttgcggcggagcaacctcgccttgcgtcagcgctgt
gaggagatggagggatggcaacgaaggacaagagaggaaagagaatttctcagctctcgt
ttccaggaggccagggccctggtggagaggctggctcaggagaaccactccttaaagggt
ctggtgaatggacctgcctcctcctctaaccactgctgcagctccagccaaaccgaagac
cagcagggacgccctgtgaggaatggcccgcttgatggaccgcagactctagatcagagg
gagaggaagagagttgaggagacagatcaacacacgcagaccacacctcctcgcagcctg
ggtgatgcaagtgtgcatagctccttgagcagcaccctccccactccccccacctcttta
tcagaggtactgggggagctaatgggcagggaaaatggccagcccgtggaaggtgctaac
gaattccttcagttgctcaagagccataaagaaaaactggaggaagggatgagagagctg
aggaggaagaatgaagagctggagagggacagagacgagggagagaaagagagagagcgg
atgcgtcgctgcattgaccagctacgagccaaattggcccaggcacaggcaagcaatgtt
actgaggaggttgttcaacatcgctccgaggcacagcactcttctgactgctctagcctg
gctaaactcacagagcagcttcaggccacacagggcaggtatcgggagctggaggagaag
cttgattacctgcagaagagttcagctcagcgggacagaactgaagctctgctcaaacag
aaggacaaggactgtgctcagatggccaaggactgtgaggctctgaaggctcaggcaact
tccctcctaggagaactgaacgagagacagagctgcttagagaaaagcgagcatgaacgc
aaaatattggaggaaaagctgtgcagtaagctgaaggccctgcaggcagcagagcgggag
ctggagcaacagaagaagcagcataatgtggcaatggacaagctgctgctgcagacccag
agcctggagcaggccctgaagacagagagacatgtcgtcacagaggagaagaaaaaactg
acacaactgcagcatgcctacacgtgtctcttcagagactatgactcgaaactgaagagt
gagggaggagatctgtgtggccgactagaggaggcagagcgagcgctggccctgaaacag
gatctgattgataagctgaaggaagaggtggagcaacagaaaggctcactggagaccgtt
cctgtcctcactgcccaggctgagatctacaaggcagatttcctagcagagcgagaagca
agagagaaattgaaccagaagaaggaagagctgcaggatcaactgaatcaggccatggct
gagatagagaggatcaaacaggacgctgcatcacgggcacgtatggagcagatgaagatg
agacacatggaagactttccaccacgggccccacttattccccctccacaaggtgtgttc
cccagtccagcttttaacacggtgccccctgcctcttcattccgcaatcagggtttggta
ccagttggtgaccaaggggcagctggaactgaggagctccctgatttatgttgtcctaag
tgccagtaccaggctccagatatggacacactgcagatacatgtcatggactgtatacag
taa

DBGET integrated database retrieval system