KEGG   Lates calcarifer (barramundi perch): 108900811Help
Entry
108900811         CDS       T04895                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14-like
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04010  MAPK signaling pathway
lcf04210  Apoptosis
lcf04625  C-type lectin receptor signaling pathway
lcf04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108900811
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108900811
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    108900811
   04672 Intestinal immune network for IgA production
    108900811
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lcf01001]
    108900811
Enzymes [BR:lcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     108900811
Protein kinases [BR:lcf01001]
 Serine/threonine kinases: STE group
  Other
   108900811
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 108900811
NCBI-ProteinID: XP_018557572
LinkDB All DBs
Position
Unknown
AA seq 856 aa AA seqDB search
MAVRQRIFNSTAPFSGSPQAELKGSCSAADQDTEEGEEEEKDSKMGFPHLNPFVNKLLTH
GTAEQMDEMHFKTSTVIAQASCETQDSQEFIPSCCERSFVPIPNCFTSSLSSEHNNVACP
TTASVQEPNGSSVQLKPRKKSRKKRKGKKRLEKKKKEKQRHRHRTPSGVPEQESGRSLVQ
VLDGTSLGGRSNLSDSCCSSIESSEEQDRGPPLYSRQIYNTCSSCSPLTWGDQVCGHLSS
LHSFERDSDSDSLSNLRHCSLALAGLRCSVSQGDPCYAGPFFKDVERDAREEEYKLSVAD
SDPNEGIIFYNDKIQPVDCEYREGREFVLTDFIKEGSYGEVRTARDVNTGFRFAIKKIAL
KRFSSEEVGAWSALRSPRVVELFGVVREGPNVLLFMDHKSGSLGQLIAKRGRLPEDLSLH
YHSQVLTGLEYLVKKKVVHLDIKAENVLLSEDGRDTFLCDFGHAERLDKQGQSLSGSNDL
KGTETHMAPEIVKGESRGAKADVWSSCCMLLHMLNGCQPWTRYYKCRLYLKIANEPPPLR
EIPPDCSPLTAEALKAGLQKDPVKRASAAELKEKTDRALKEVGGLTSPVKGPYTEPLYIA
NEPPDSLQPINSSVDYEDEVEHEESVERAITAGRRAKELDDEEEEKEADSNESKRGSQCY
PQMLISEPNHKRSNKETTVPELELRKLARDFYLSSLSQPQSVEMQEHLLSCLSSENWEQW
DKKDSGRWSLSPGDDFSSGVFSYNSQPDVQVFSMDFLGHRQLPPPCCFEGVDVCIRDFSR
RSIRIRETRRVKVGHIATGISDQISERVFTLETQQGQQIAHDEEVQESGLELCCVAAPDY
SPAWRWRIRDGVLETR
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atggcggttaggcagaggattttcaactcaacagcaccattctccggatcgccccaggct
gagctgaaggggtcttgctcagccgcagaccaggacacggaggagggggaagaggaggag
aaggacagcaagatgggcttcccacacttaaacccctttgttaataaactcttgacccat
ggaactgcagagcaaatggatgaaatgcactttaagacctcaacagtcattgctcaggct
tcatgtgaaacccaggactcccaagagtttatcccatcttgttgtgaacgatcctttgtt
cccatccccaactgcttcaccagcagtctttcctcagagcacaacaacgtggcatgccca
acgacagcttctgtccaggagcccaacggctcatcagtgcagctcaaacccaggaaaaag
agcaggaagaagcgtaaggggaagaaaaggctggagaagaagaagaaggagaagcagcga
cacagacatcgaacaccctctggagtccctgaacaggagagtggaagatctctggttcaa
gtcctggatgggacatctcttggaggaagaagcaacctcagtgattcttgctgtagcagc
attgaaagctcagaggagcaggacagagggcctcccctctacagccgacagatctacaac
acatgctccagctgctcacccctgacctggggggaccaggtctgcggccacctctccagt
ctccactccttcgagcgggacagcgactcagactccctcagcaatttgagacactgctcg
ctggccctcgctggcctcaggtgtagcgtcagtcagggggacccgtgctacgcagggccc
ttcttcaaagatgtggagagggatgcgagagaagaggaatacaagctctcagtagctgat
tctgaccccaacgagggaatcatcttttacaatgataaaattcagcctgtggactgcgag
tacagggaagggagggagtttgtcctcacagattttatcaaggaaggctcctacggtgaa
gtgcgcaccgctcgagatgtcaacacaggcttcagatttgccatcaaaaagatcgccctg
aagaggttcagcagtgaggaggtgggtgcgtggagtgccctcagatctcctcgcgtggtg
gaactcttcggagtggtcagagaggggcctaatgttctactcttcatggaccacaaatct
ggctctctgggccagttgatagccaagcgtggccggctgccagaggatttgagcctccac
taccactcgcaagtcttaacagggctggagtacttggtaaagaaaaaggtggtgcaccta
gatataaaagctgaaaatgtgttgctgtcggaggacggtagagacaccttcctgtgcgac
ttcggacacgcagagagactggacaaacaggggcagagcctcagcgggtccaacgatctg
aagggcacagagacccacatggcccctgagatcgttaaaggggaatcccgcggagccaaa
gcagatgtgtggagcagctgctgcatgttactgcacatgctgaacgggtgtcaaccttgg
acaagatactacaaatgtagactttacctcaagattgctaatgagcctccgcctctgaga
gagatcccacctgactgtagtcctctcactgctgaagcacttaaggcgggacttcagaag
gatccagtcaagagagcatcagcagcagagctcaaagaaaaaactgacagagctctgaaa
gaagtgggaggcctcaccagcccagtgaagggaccctacactgagcccctgtacatagcc
aatgaacctccagactccctgcagcccatcaacagcagcgttgactatgaagacgaggtg
gaacatgaagagtctgtggagagggcgatcacagcagggaggagggcaaaggagctggat
gatgaggaggaagagaaggaggctgacagtaatgagtcaaagcgaggctcgcagtgctat
ccacagatgctgatctctgagccaaaccacaagaggagcaacaaggagaccactgtgccc
gaacttgagctacgtaaactggcgcgagatttctacctgagcagtctgtctcagcctcag
tctgttgagatgcaggagcatctcttgtcctgcctcagcagtgaaaattgggaacaatgg
gacaaaaaggactctggccgctggtccctgagcccaggagacgacttcagctctggcgtc
ttctcctacaacagtcagcccgatgtgcaggtcttcagtatggatttcctgggtcacagg
cagctaccaccaccctgctgttttgaaggggtggacgtctgcatcagagacttcagcagg
aggagcatccggatcagggagacacgccgggtgaaggtgggccacatcgcgaccggaatc
agtgatcagatctctgagagagttttcactctagagacacagcaaggccagcagatcgct
cacgatgaggaggtgcaggagtccggtctggagctctgctgtgttgccgccccagactac
agtcctgcctggaggtggaggatcagagatggagtgctggagacgagatag

DBGET integrated database retrieval system