KEGG   Lates calcarifer (barramundi perch): 108902165
Entry
108902165         CDS       T04895                                 

Gene name
epo
Definition
(RefSeq) erythropoietin isoform X1
  KO
K05437  erythropoietin
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108902165 (epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lcf04052]
    108902165 (epo)
Cytokines and growth factors [BR:lcf04052]
 Cytokines
  CSF and other factors
   108902165 (epo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 108902165
NCBI-ProteinID: XP_018559424
LinkDB
Position
Unknown
AA seq 216 aa
MGNRRTYGPNREDPVKGYADTAMEFPRLLALLLIVLEWTRPGLPTPLRPICDLRVLDHFI
KEARDAEVAMKSCREGCSLSDSVTVPQTTVDFDVWEKKNTSTLALSSFCGKALEQAQEVQ
SGLWLLQQALSLLRTSVTNTAMHSHIDNSIRNLLSINAVLRSLNIQEYTPPASTAGLEGT
WRVSSATDLLQVHVNFLRGKVRLLLLDAQACQQDVS
NT seq 651 nt   +upstreamnt  +downstreamnt
atgggcaatagacggacctatgggccaaaccgcgaggaccctgtgaagggctatgcggac
accgctatggagtttcccagactgcttgccttgctgttgatagtgttggagtggacccgg
ccaggcctaccgaccccactgaggccaatctgtgacctgagggtcctggaccatttcatt
aaggaagcacgagacgctgaagttgctatgaagtcatgtagagagggatgtagcctgtca
gactcggtcactgttccccaaaccacagtcgactttgatgtctgggagaagaaaaatact
tcaactcttgccctctcttcattttgtggaaaggcattggagcaggcccaggaggtgcag
tctggcttatggcttttacaacaggccctcagcttgctacggacctcggtcaccaacaca
gcaatgcacagccacatagataactccattcgaaacctgctcagcatcaatgctgtgctg
cgcagtctcaacatccaggaatataccccaccagcaagcacagcagggcttgagggaaca
tggagggtgtcctcagctaccgatctgctacaagtccatgtcaatttcttgcgaggcaaa
gtgcgcctcctccttttggatgcacaggcttgtcagcaagatgtcagctga

DBGET integrated database retrieval system