KEGG   Lates calcarifer (barramundi perch): 108903091Help
Entry
108903091         CDS       T04895                                 

Definition
(RefSeq) coagulation factor XIII A chain-like
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
lcf  Lates calcarifer (barramundi perch)
Brite
Enzymes [BR:lcf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     108903091
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 108903091
NCBI-ProteinID: XP_018560703
LinkDB All DBs
Position
Unknown
AA seq 742 aa AA seqDB search
MSDQSVTPTPSDPPPPPSGRPPKVINRGRTTVPIASSNSESTDVPEFEHFGVPGPRGLPP
LTEYLDILDVDMMKKPNESNKMNHHTALYQSDNLIIRRGQEFEVKITFNRPFNSAQDKFA
VEFVIGSSPQYSKGTYIPVFPTKDRQSPWAGRITNTSDNTITMGITPAADCIVGKYHMYV
AVATPYGIRRTRRDISRDLYILFNPWVADDAVFLDDEKERDECVMSEMGIIYHGAYDDIS
ERNWNYGQFNYGVLDACLYIMDRSEMPITNRGDPIKVTRKASAMLNSRDDDGVLVGSWSG
DYSYGVAPTSWTGSTDILLSYASSKMPVCYAQCWVYAAVFNTFLRCLGIPSRVVTNFFSA
HDNDGNLKTDIILDENGRIDRKRTKDSIWNYHCWNECYMSRPDLPTGFGGWQVVDATPQE
TSDGMYRCGPASVQAIKHGQICFPFDAAFVFAEVNSDVVFYSRKKDGTLEPVKVNRTHIG
RLVLTKNPGDLTRRDITSQYKFSEGSTEERTVLEKAEEYGCKREKSNPALADVDLVLPTL
EISVGDDFELSVEFINRSDQERTVDTYISGNVVYYTGVSSSEFLFRTPTVEIEPNQTVKE
LVSVQSKSYMKQLVEQANLHFIVTGKVNETGQIITAMKVVTLRNPKLSVEVSGGGKVNEE
MMATVQFTNPFTFNLEGVYIRMEGPGVMSPKFKYYSLIPGGSSLTWAEFFTPQRSGSTRM
IATLDCPALRQVYGQATITIEP
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatcaaagtgtcaccccgactccctctgatcccccccctccaccctctggacgc
cctcccaaggtgataaaccgtggccgcaccacagttcccatcgccagctccaactctgag
tcaaccgacgtcccagagtttgaacactttggtgtaccgggcccaagaggactcccaccc
ctgactgagtatcttgacatcttagacgtggacatgatgaagaagccgaatgagagcaac
aagatgaatcaccacaccgcgttgtaccagtctgacaatctcatcatccgcagaggacag
gagtttgaggtcaagatcaccttcaaccgtccgttcaattctgctcaagacaagtttgct
gtggagtttgtcattggctccagcccacagtacagcaagggcacctacattcctgtcttc
cccactaaggatcgtcagagcccctgggcaggccgcatcacaaacacatcagacaacacg
atcaccatgggcatcacccctgctgccgactgcattgtggggaaataccacatgtacgtt
gccgtggcgacgccctacggcatccgcaggaccagacgggacatcagccgagacctctac
atcctcttcaacccctgggtggcagatgatgctgtgtttctggatgatgagaaagagagg
gatgagtgtgtgatgagtgagatggggatcatctaccacggcgcctacgacgacatctct
gagagaaactggaactatggacagttcaactatggagtcctggatgcctgtctgtacatc
atggacaggtctgagatgcctatcaccaacagaggagaccccatcaaagtgaccagaaag
gcgtctgctatgctgaactctcgtgatgacgatggcgtgttggtggggagctggagtggc
gactacagctacggagtggcgcccacttcctggactggcagcacagacattctgctcagc
tacgccagcagcaagatgcctgtctgctacgctcagtgctgggtctacgccgccgttttc
aacacctttctgcgctgtctgggcatcccatcccgggtcgtcaccaacttcttctcagcc
catgacaacgatggaaacctgaagactgacatcatcctggatgagaacggcaggattgac
cgcaagcgtaccaaggactctatctggaactatcactgctggaatgagtgctacatgtcc
aggcctgacctcccaactggatttggaggttggcaagttgtggatgcaacaccacaggag
accagtgatggcatgtacagatgtggtcctgcatcagtccaggccatcaaacatgggcag
atatgcttcccctttgatgctgcctttgtgtttgctgaggtcaacagcgatgtggtgttt
tattcccggaagaaagatggaacattggaaccagtcaaagtgaaccggactcacataggc
cgcctggttttgaccaaaaatccaggggacttgacccgtcgagacatcaccagtcagtac
aagttctctgaaggcagtacagaggagcgtacggtcctggaaaaagcagaggagtatggc
tgcaaacgagagaagtccaaccctgccctggctgatgtggacctggtcctgcccaccctg
gagatcagcgtgggcgatgactttgagctgagcgtggagttcataaaccggagcgaccag
gagcgcaccgtggacacctacatcagtgggaacgtggtgtattacaccggagtgtccagc
tctgagttcctgttcaggactcccacagttgagattgagcccaaccaaactgtgaaggag
ttggtgtctgtccagtcaaagagctacatgaagcaactggtggaacaggccaaccttcac
ttcatcgttactgggaaggtcaacgagaccggccagatcatcaccgccatgaaagtcgtc
accctacgcaatcccaagctcagcgttgaggtttccggtggaggcaaagtgaatgaggag
atgatggcgaccgtgcagtttacaaaccccttcaccttcaacctggagggtgtctacatt
cgcatggagggacctggggtcatgtcacccaagttcaaatattacagtctgatcccagga
ggctcctctctgacctgggccgagtttttcaccccgcagaggagcggctccaccaggatg
atcgctactctggactgtcctgctctcaggcaggtctacggccaggcaaccatcaccatc
gagccctga

DBGET integrated database retrieval system