KEGG   Leptothrix cholodnii: Lcho_0259Help
Entry
Lcho_0259         CDS       T00681                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
lch  Leptothrix cholodnii
Brite
KEGG Orthology (KO) [BR:lch00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Lcho_0259
Enzymes [BR:lch01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Lcho_0259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_oxidored GIDA FAD_binding_2 Glutaredoxin DAO HI0933_like FAD_binding_3 Thi4 NAD_binding_8 K_oxygenase AlaDh_PNT_C FMO-like baeRF_family10
Motif
Other DBs
NCBI-ProteinID: ACB32534
UniProt: B1Y7T6
LinkDB All DBs
Position
274065..275648
Genome map
AA seq 527 aa AA seqDB search
MLDQALKTQLKSYLERLQRPIELVASLDDSAKSAELRGLLQDIAGLSPQVSLVERDDGQR
TPSFTIGAAGADEAARIRFAGIPLGHEFTSLVLALLQTGGHPPKVEAGVIEQIRGLDADL
SFEVYMSLTCHNCPDVVQALNLMAVLNPGVKVTTIDGALFQDEIAQRQIMAVPTVFLNGQ
EFGAGRMTVEDILAKVDTGAAARDAARLAKQAAYDMLIVGGGPAGAAAAVYAARKGIRTG
VVAERFGGQTLDTMAIENFISVKETDGPKFAVALEQHVKQYDVDIMNAQRAVKLTPATEP
GGLAELELANGAVLKARSVILSTGARWRNVNVPGEAEYKNKGVAYCPHCDGPLFKGKRVA
VIGGGNSGVEAAIDLAGIVKHVTLIEFADALRADAVLVAKLKSLPNVAIHTSAQTTEIHG
DGQKVNGLSYTDRVSGAGHRIDLEGVFVQIGLVPNTEWLKGTIELSRHGEIIIDARGQTN
VPGIYAAGDVTTVPFKQIVIAVGEGAKAALGAFDHLMRTPVVAAETA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgttggaccaagccctcaagacccaattgaagagctacctcgagcgcctgcaacggccg
atcgagctggtggcgtctctcgacgacagcgccaagagcgccgaactgcgcggcctgctg
caggacatcgccggcctgtcgccccaggtgagcctggtcgagcgcgacgacggccagcgc
acgccctcgttcacgatcggtgcggccggcgccgacgaggccgcccgcatccgctttgcc
ggcatcccgctgggccacgagttcacctcgctggtgctggcgctgctgcagaccggcggc
cacccgcccaaggtcgaggccggcgtgatcgagcagatccgcggcctggacgccgacctc
agcttcgaggtctacatgtccctgacctgccacaactgcccggacgtggtgcaggcgctc
aacctgatggcggtgctcaaccccggcgtcaaggtgacgacgatcgacggcgcgctgttc
caggacgagatcgcgcagcgccagatcatggcggtgcccaccgtgttcctgaacggccag
gagttcggcgccggccgcatgacggtcgaagacatcctcgccaaggtcgacaccggcgcg
gccgcgcgtgatgcggctcggctggccaagcaggcggcctacgacatgctgatcgtcggc
ggcggcccggccggcgcggcggcggcggtgtacgcggcgcgcaagggcatccgcacgggc
gtggtggccgagcgtttcggcggccagacgctcgacacgatggcgatcgagaacttcatc
tcggtcaaggaaaccgacgggccgaagttcgcggtggcgctggagcagcacgtcaagcag
tacgacgtcgacatcatgaacgcgcagcgcgccgtcaagctgaccccggccaccgagccg
ggagggctggccgagctggaactggccaacggcgcggtgctgaaggcgcgcagcgtgatc
ctgagcaccggcgcgcgctggcgcaacgtcaacgtgcccggcgaggccgagtacaagaac
aagggcgtggcctactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcg
gtgatcggcggcggcaactcgggcgtcgaggcggcgatcgacctggccggcatcgtcaag
cacgtgacgttgatcgaattcgccgacgcgctgcgcgccgacgcggtgctggtggccaag
ctcaagagcctgcccaacgtggcgatccacaccagcgcgcagaccaccgagatccacggc
gacggccagaaggtcaacggcctgagctacaccgaccgtgtcagcggcgcgggccatcgg
atcgatctcgaaggcgtgttcgtgcagatcggcctggtgcccaacaccgagtggctcaag
ggcacgatcgagctcagccgccacggcgagatcatcatcgacgcccgcggccagaccaat
gtgcccggcatctacgccgccggcgacgtgacgacggtgccgttcaagcagatcgtgatc
gcggtgggcgagggcgcgaaggccgcactcggcgccttcgaccacctgatgcgcacgccg
gtggtggcggccgagacggcctga

DBGET integrated database retrieval system