KEGG   Leptothrix cholodnii: Lcho_0310Help
Entry
Lcho_0310         CDS       T00681                                 

Definition
(GenBank) Glutathione S-transferase domain
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
lch  Leptothrix cholodnii
Pathway
lch00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:lch00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Lcho_0310
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lch02000]
    Lcho_0310
Enzymes [BR:lch01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Lcho_0310
Transporters [BR:lch02000]
 Other Transporters
  Pores ion channels [TC:1]
   Lcho_0310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_N_3 GST_C_3 GST_N_2 GST_C_2 Tom37
Motif
Other DBs
NCBI-ProteinID: ACB32585
UniProt: B1XW58
LinkDB All DBs
Position
complement(335661..336269)
Genome map
AA seq 202 aa AA seqDB search
MKLYYSPGACSLSPHIALRETGLPFELVLASTKTKKLADGSDYLAINPKGQVPMLALDDG
TQITEGPAIVQYIADQAPASGLAPAAGTIERYKLMEWLNFITSELHKGFSPLFAPDTPDD
YKPIARNRLLARLAYVDEQLADRSYLLGEQYSVADIYLFVVSGWGQYVGVDISGLPRLMA
FRARIAARPAVIAAMKAEGLIK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctactacagccccggcgcctgctcgctgtcgccccacatcgccctgcgcgag
accggcctgccgttcgaactggtgctcgccagcaccaagaccaagaagctggccgacggc
agcgactacctggccatcaacccgaagggccaggtgccgatgctggcgctcgacgacggc
acccagatcaccgaaggaccggccatcgtgcagtacatcgccgaccaggcgcccgccagc
ggcctggccccggcggccggcacgatcgagcgctacaagctgatggagtggctgaacttc
atcaccagcgagctgcacaagggtttctcgccgctgttcgcccccgacacgcccgacgac
tacaagccgatcgcgcgcaatcgcctgctcgcccgcctggcctatgtcgacgagcagctc
gccgaccgcagctacctgctcggcgagcagtacagcgtggccgacatctacctgttcgtg
gtctcgggctggggccagtacgtgggcgtggacatctccgggctgccccggttgatggcg
tttcgcgcgcgcatcgccgcccgcccggccgtgatcgcggcgatgaaggccgaaggcctg
atcaagtaa

DBGET integrated database retrieval system