KEGG   Leptothrix cholodnii: Lcho_1190
Entry
Lcho_1190         CDS       T00681                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K07534  cyclohex-1-ene-1-carboxyl-CoA hydratase [EC:4.2.1.-]
Organism
lch  Leptothrix cholodnii
Pathway
lch00362  Benzoate degradation
lch01100  Metabolic pathways
lch01120  Microbial metabolism in diverse environments
lch01220  Degradation of aromatic compounds
Module
lch_M00540  Benzoate degradation, cyclohexanecarboxylic acid =>pimeloyl-CoA
Brite
KEGG Orthology (KO) [BR:lch00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Lcho_1190
Enzymes [BR:lch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-  
     Lcho_1190
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: ACB33459
UniProt: B1Y4M0
LinkDB
Position
1275801..1276577
AA seq 258 aa
MTEHPILTETVGRVGVITLNRPRQLNALNDALMDALGAALLAFDADEAIGVIVVTGGPKA
FAAGADIAAMVDWTYMDVYRSEFITRNWETIRRVRKPVIAAVAGFAMGGGCELALSCDIV
IAAESAKFALPEIKLALLPGAGGTQRLPRAIGKAKAMDMCLSARTLDATEADRYGLVSRV
VPDEQLMATSLALATTIAGYSLPALMALKESVNRAWEGSLAEGIAYERRELHARFASADA
HEGMRAFLDKRKPEFKHR
NT seq 777 nt   +upstreamnt  +downstreamnt
atgaccgaacaccccatcctcaccgagaccgtcggccgcgtcggcgtcatcacgctgaac
cggccccgccagctcaacgcgctcaacgacgccctgatggacgcgctgggtgccgcgctg
ctggccttcgatgcggacgaggccatcggcgtcatcgtcgtcaccggcggccccaaggcc
ttcgcggccggcgccgacatcgccgcgatggtcgactggacctacatggacgtctaccgc
agcgagttcatcacccgcaactgggaaaccatccgccgcgtgcgcaagccggtgatcgcc
gcggtggccggcttcgcgatgggcggcggctgcgagctggcgctgtcgtgcgacatcgtg
atcgccgccgagagcgcgaagttcgcgctgcccgagatcaagctcgcgctgctgccgggt
gccggtggcacgcagcgcctgccgcgcgcgatcggcaaggccaaggcgatggacatgtgc
ctgtcggcccgcaccctcgatgccaccgaggccgatcgctacgggctggtctcgcgcgtg
gtgcccgacgagcagctgatggccaccagcctggcgctcgccaccaccatcgccggctac
tcgctgccggcgctgatggcgctgaaggagtcggtcaaccgggcctgggagggctcgctc
gccgaaggcatagcctacgagcggcgcgagctgcacgcgcgctttgctagcgccgacgcc
cacgaaggcatgcgcgccttcctcgacaagcgcaagcccgaattcaagcaccgctga

DBGET integrated database retrieval system