KEGG   Leptothrix cholodnii: Lcho_1698Help
Entry
Lcho_1698         CDS       T00681                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
lch  Leptothrix cholodnii
Pathway
lch00061  Fatty acid biosynthesis
lch00780  Biotin metabolism
lch01100  Metabolic pathways
lch01130  Biosynthesis of antibiotics
lch01212  Fatty acid metabolism
Module
lch_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:lch00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Lcho_1698
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Lcho_1698
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Lcho_1698
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lch01004]
    Lcho_1698
Enzymes [BR:lch01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Lcho_1698
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Lcho_1698
Lipid biosynthesis proteins [BR:lch01004]
 Fatty acid synthase
  Component type
   Lcho_1698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short DUF2787
Motif
Other DBs
NCBI-ProteinID: ACB33965
UniProt: B1XY64
LinkDB All DBs
Position
complement(1812987..1813784)
Genome map
AA seq 265 aa AA seqDB search
MGFLAGKRLLITGLLSNRSIAYGIARACHREGAELAFSYVGERFKERTAEFAAEFDSKLI
YDCDVGSDEQIDRMFADLAKDWEGGFDGFVHSIGFAPREAIAGDFIEGLSRESFRIALDI
SAYSFPAMAKAALPHLRERSSMLTLSYLGAMRVVPNYNTMGLAKAALEASVRYLASNLGP
RGIRVNGISAGPIKTLAASGIKDFGKLLALFSQNAPIRRTVTIDEVGNVAAFLLSDLASG
MTSEITYVDGGFSHVMVSSSGAEST
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgggctttctcgctggcaagcgccttctgatcaccggactgctgtccaaccgctcgatt
gcctacggcattgcgcgcgcctgccaccgcgaaggcgccgaactcgctttcagttacgtg
ggtgaacgcttcaaggaacgcacggccgagttcgcagccgaattcgattccaagctgatc
tacgactgcgacgtcggcagcgacgaacagatcgatcgcatgtttgccgacctggccaaa
gactgggaaggcggcttcgacggcttcgtgcactcgatcggcttcgcgccgcgcgaggcc
atcgccggcgacttcatcgaaggcctgagccgcgagtcgttccgcatcgccctcgacatc
tcggcctacagcttcccggccatggccaaggcagcgctgccccacctgcgtgaacgcagc
tcgatgctgacgctgagctacctgggcgcgatgcgcgtggtgccgaactacaacaccatg
ggcctggccaaggccgcgctcgaagccagcgtgcgttatctcgcgtcgaacctgggcccg
cgcggcatccgcgtcaacggcatctcggccggcccgatcaagaccctggccgccagcggc
atcaaggacttcggcaagctgctggcgctgttttcgcagaacgcgccgattcgccgcacg
gtcacgatcgacgaggtcggcaacgtcgccgccttcctgctctccgacctggcctcgggc
atgacgtccgaaatcacctacgtcgatggcggcttcagccatgtgatggtgagcagcagc
ggcgccgagagcacctga

DBGET integrated database retrieval system