KEGG   Leptothrix cholodnii: Lcho_2958Help
Entry
Lcho_2958         CDS       T00681                                 

Definition
(GenBank) Glutathione S-transferase domain
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
lch  Leptothrix cholodnii
Pathway
lch00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:lch00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Lcho_2958
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lch02000]
    Lcho_2958
Enzymes [BR:lch01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Lcho_2958
Transporters [BR:lch02000]
 Other Transporters
  Pores ion channels [TC:1]
   Lcho_2958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: ACB35222
UniProt: B1XYH7
LinkDB All DBs
Position
3257925..3258560
Genome map
AA seq 211 aa AA seqDB search
MSELVLYTNPQSRGRIAHWMIEETGLPYRTEWVAYGPPMKGQPYRSINPMGKVPALQDGS
AVVTEAAAICAWLAERNPEAALAPPIGSPVRAAYYRWLFFAAGPLEQATTARAMGWQVPE
GRNGMVGFGCYEDTLNALESALQPGPWICGEPFTAADVYIGSALGWGMMFGTIDKRPAFE
AYVTRARARPAWLRAEALNAARLKETEAAKH
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactggtcctgtacacgaacccgcagtcacgcggtcgcatcgcccactggatg
atcgaggaaaccggcctgccctaccgcaccgaatgggtcgcttacggcccgccgatgaag
ggccagccctaccgctcgatcaacccgatgggcaaggtgccggcgctgcaggacggcagc
gcggtggtgaccgaagccgccgcgatctgtgcctggttggccgaacgcaaccccgaagcc
gcactcgccccgccgatcggcagcccggtgcgcgccgcctattaccgctggctgttcttc
gccgccggcccgctggagcaggccaccaccgcccgcgcgatgggctggcaggtgcccgaa
ggccgcaacggcatggtcggtttcggctgctacgaggacaccctgaacgcgctggaatcg
gcgctgcagcctggcccctggatctgcggcgaaccgttcaccgccgccgacgtctacatc
ggctcggcgctcggttggggaatgatgttcggcaccatcgacaagcggccggcgttcgag
gcctatgtgacgcgggcgcgggctcggccggcctggttgcgggcggaggcgttgaatgcg
gcgcggttgaaggaaacagaggccgccaagcactga

DBGET integrated database retrieval system