KEGG   Leptothrix cholodnii: Lcho_3864Help
Entry
Lcho_3864         CDS       T00681                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
lch  Leptothrix cholodnii
Brite
KEGG Orthology (KO) [BR:lch00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:lch03012]
    Lcho_3864
   03029 Mitochondrial biogenesis [BR:lch03029]
    Lcho_3864
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lch04147]
    Lcho_3864
Translation factors [BR:lch03012]
 Eukaryotic Type
  Elongation factors
   Lcho_3864
 Prokaryotic Type
   Lcho_3864
Mitochondrial biogenesis [BR:lch03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Lcho_3864
Exosome [BR:lch04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Lcho_3864
  Exosomal proteins of breast cancer cells
   Lcho_3864
  Exosomal proteins of colorectal cancer cells
   Lcho_3864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW AAA_29
Motif
Other DBs
NCBI-ProteinID: ACB36118
UniProt: B1Y7H0
LinkDB All DBs
Position
4332224..4333414
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAAKFGGSAKAYDQIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLDKYEFPGDDTPIVHGSAKLALE
GDKGPLGEQAIMKLADALDSYIPTPERAVDGAFLMPVEDVFSISGRGTVVTGRIERGIIK
VGEAIEIVGISATQNTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVQRGQVLCKPGS
VKPHTHFTGEIYVLSKEEGGRHTPFFNNYRPQFYFRTTDVTGAIELPKDKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggaaaagtttgagcggaccaagccgcacgtcaacgtcggcacgatcggtcac
gtggaccacggcaagacgacgctgacggcggcgatcacgaccgtgctggcagccaagttc
ggcggctcggccaaggcgtacgaccagatcgacgcagcgcccgaagagaaggcacgcggc
atcaccatcaacaccgcgcacgtcgagtacgaaacggccaaccgccattacgcacacgtc
gactgcccgggtcacgccgactacgtcaagaacatgatcaccggcgccgcccagatggac
ggcgcgatcctggtgtgctcggccgccgacggcccgatgccccagacccgcgagcacatc
ctgctggcgcgtcaggtcggtgtgccgtacatcatcgtgttcctgaacaagtgcgacatg
gtcgacgacgccgagctgctcgagctggtcgaaatggaagtgcgcgagctgctcgacaag
tacgagttcccgggtgacgacaccccgatcgtgcacggcagcgccaagctcgccctcgaa
ggcgacaagggcccgctgggcgagcaggccatcatgaagctggccgatgcgctcgacagc
tacatccccacgcccgagcgcgcggtcgacggcgccttcctgatgccggtcgaagacgtg
ttctcgatctcgggtcgcggcaccgtggtgaccggccgtatcgagcgcggcatcatcaag
gtcggcgaagccatcgagatcgtcggcatcagcgccacgcagaacaccacctgcaccggc
gtcgagatgttccgcaagctgctcgaccaaggtcaggcgggcgacaacgtcggcatcctg
ctgcgcggcaccaagcgcgaagacgtgcagcgcggccaagtgctgtgcaagccgggcagc
gtcaagccgcacacccacttcacgggcgagatctacgtgctgagcaaggaagaaggcggc
cgccacacgccgttcttcaacaactaccgcccgcagttctacttccgcaccaccgacgtc
accggcgccatcgagctgcccaaggacaaggaaatggtcatgcccggtgacaacgtgtcg
atcacggtcaagctgatcgccccgatcgccatggaagaaggcctgcgtttcgccatccgc
gaaggcggccgtaccgtcggcgccggcgtcgtggccaagatcatcgcgtaa

DBGET integrated database retrieval system