KEGG   Leptothrix cholodnii: Lcho_4382Help
Entry
Lcho_4382         CDS       T00681                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
lch  Leptothrix cholodnii
Pathway
lch00020  Citrate cycle (TCA cycle)
lch00480  Glutathione metabolism
lch01100  Metabolic pathways
lch01110  Biosynthesis of secondary metabolites
lch01120  Microbial metabolism in diverse environments
lch01130  Biosynthesis of antibiotics
lch01200  Carbon metabolism
lch01210  2-Oxocarboxylic acid metabolism
lch01230  Biosynthesis of amino acids
Module
lch_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lch_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:lch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Lcho_4382
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Lcho_4382
Enzymes [BR:lch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Lcho_4382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ACB36633
UniProt: B1Y0F4
LinkDB All DBs
Position
4901216..4903453
Genome map
AA seq 745 aa AA seqDB search
MPAEKAKIIYTLTDEAPLLATYSFLPIVRTFAAPAGIDVVESDISVAARVLGEFPEYLSD
EQRVPDNLKELGRLTLLPDTNIIKLPNISASQNQLITCIRELQSKGYALPDFPEQPKTDE
EKAIRLRYNKCMGSAVNPVLREGNSDRRAPRAVKEYARKNPHSMAEWSQASRSHVSHMHH
GDFYHGEKSITLDKARDVKMELLTKSGKTILLKPKVSLLDREVIDSMFMSKKELLAFYEK
EIEDAHKTGVMFSLHVKATMMKVSHPIVFGHCVKIFYKDAFAKHAKLFDELGVNVNNGMA
NLYDKIATLPQSKQDEIKRDLHACHENRPELAMVDSAKGITNFHSPNDVIVDASMPAMIR
NGGKMWGADGRLKDVKAVMPESTFARIYQEIINFCKWHGAFDPKTMGTVPNVGLMAQQAE
EYGSHDKTFEIPEDGVANITDLNTGEVLLSQNVEEGDIWRMCQVKDAAIRDWVKLAVNRA
RNSGMPVVFWLDAYRPHEAQLITKVKMYLHEHNTSGLDIQIMSQVRAMRYTLERVIRGQD
TISATGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEEN
HLRWDSLGEFLALAVSMEDLGIKTGSNKAKILARTLDAATGKLLDNNKGPSPKTGQLDNR
GSQFYLAMYWAQGLAEQTEDLELQAHFTGLAKSLTENEQKIADELKAVQGQPVDIGGYYF
ADPQKVTAVMRPSATFNAALAAAQL
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgcccgctgaaaaagccaagatcatctacaccctgaccgacgaggcgcccttgctggcg
acttattcgtttctgccgatcgtgcgcactttcgctgcgcctgcgggcatcgacgtcgtc
gagtccgatatctcggtggcggcacgcgtgctgggtgaattccccgagtacctgagcgac
gagcagcgggtgccggacaacctgaaggaactcggccggctcaccctgctgcccgatacc
aacatcatcaagctgcccaacatcagcgcgtcgcagaaccagttgatcacctgcatccgc
gagttgcagtccaagggctacgcgctgcccgacttccccgagcagcccaagaccgacgag
gaaaaggcgatccgcctgcgctacaacaagtgcatgggcagcgcggtgaacccggtgctg
cgcgaaggcaactccgaccgccgcgcgccgcgcgccgtcaaggaatacgcccgcaagaac
ccgcacagcatggccgagtggagccaggcgtcgcgttcgcacgtctcgcacatgcaccac
ggcgacttctatcacggcgaaaagtcgatcacgctcgacaaggcgcgtgacgtcaagatg
gaactgctcaccaagagcggcaagaccatcctgctcaagccgaaggtctcgctgctcgac
cgcgaagtcatcgacagcatgttcatgagcaagaaggaactgctggccttctacgagaag
gagatcgaggacgcgcacaagaccggcgtgatgttctcgctgcacgtcaaggcgaccatg
atgaaggtgtcgcacccgatcgtgttcggccactgcgtcaagatcttctacaaggacgcg
ttcgccaagcacgccaagctgttcgacgagctgggcgtgaacgtcaacaacggcatggcc
aacctgtacgacaagatcgccaccctgccgcagagcaagcaggacgagatcaagcgcgac
ctgcacgcctgccacgagaaccgccccgagctggcgatggtcgattcggccaagggcatc
accaacttccactcgccaaacgacgtgatcgtcgacgcctcgatgccggcgatgatccgc
aacggcggcaagatgtggggtgccgacggccgcctgaaggacgtcaaggccgtgatgccg
gagtcgaccttcgcccgcatctaccaggagatcatcaacttctgcaagtggcacggcgcc
ttcgaccccaagaccatgggcacggtgcccaacgtcggcctgatggcccagcaggccgag
gaatacggctcgcacgacaagaccttcgagatccccgaagacggcgtggccaacatcacc
gacctgaacaccggcgaagtgctgctgagccagaacgtcgaagagggcgacatctggcgc
atgtgccaggtcaaggacgccgccatccgcgactgggtcaagctggccgtcaaccgcgcg
cgcaactccggcatgccggtggtgttctggctcgacgcctaccgtccgcacgaggcgcag
ctgatcaccaaggtcaagatgtacctgcacgagcacaacacctccggcctggacatccag
atcatgagccaggtgcgtgccatgcgttacaccctggagcgcgtgatccgcggccaggac
accatcagcgccaccggcaacatcctgcgcgactacctcaccgacctgttcccgatcatg
gaactgggtaccagcgccaagatgctgtcgatcgtgccgctgatggccggtggcggcatg
tacgagaccggtgccggcggttcggcgcccaagcacgtgcagcagctggtcgaggaaaac
cacctgcgctgggattcgctcggcgagttcctggcactggcggtcagcatggaagacctc
ggcatcaagaccggcagcaacaaggccaagatcctggctcgcacgctcgacgccgccacc
ggcaagctgctcgacaacaacaagggcccgtcgcccaagaccggccagctcgacaaccgc
ggcagccagttctacctggcgatgtactgggcccagggcctggccgagcagaccgaggac
ctggagctgcaggcccacttcaccggcctggccaagtcgctgacggaaaacgagcagaag
atcgccgacgagctgaaggccgtgcagggccagccggtcgacatcggcggctactacttc
gccgatccgcagaaggtgacggccgtgatgcgtccgagcgcgaccttcaacgccgccctg
gcggctgcgcagctctga

DBGET integrated database retrieval system