KEGG   Leuconostoc citreum: LCK_00219Help
Entry
LCK_00219         CDS       T00663                                 

Definition
(GenBank) Amino acid transporter
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
lci  Leuconostoc citreum
Brite
KEGG Orthology (KO) [BR:lci00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    LCK_00219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C
Motif
Other DBs
NCBI-ProteinID: ACA82052
UniProt: B1MX00
LinkDB All DBs
Position
complement(227368..228768)
Genome map
AA seq 466 aa AA seqDB search
MSIFARAFKRESVDNYMQADSHMSRILTTRDLIGLGVGTVIGTGIFILPGHEAAQHAGPA
VSIAFLIAAIYSGLSGMSFAEFSSAMPVAGSAYSYGSVIYGEIIGWLLGWSLILEYFLAV
SAIATGFSAYLNNLLLTFGVHMPKSLLAGPMEGGIVNLFAVMIILLVTAILSRGLNASKK
IENGAVILKVAILGLFIIGGSFFIKHTNYVPFYPKEFHTGLLGLNGIMSATASIIFAFLG
FDTIAAHAAEVKNPQKTMVRGIVGTVLISALLYVLFSIVLTGIVNYKQLGVDDPAAFALQ
AIHQTQFAVVITVGALVGMFTAILALIYASSRLTYSFGRDGLLPRSLGKISKSSRLPVNA
LLVAVVIEAIFAGLIPLNTLASLINAGTLLAFTFINFGVLILRRRPDLAHDGFKVPGYPV
IPFIAGIISLYLITKLPIDTLELFSIWVLIGVAWYFIYGMRHSKLS
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtctatctttgcgagagcatttaaacgagaatctgttgataattatatgcaagccgat
tctcatatgtcacgaatattaaccacacgtgatctcataggccttggtgttgggactgtg
attgggactggaatatttattttgcccggccatgaagctgctcaacatgccggcccagcg
gtatctattgcttttcttattgcggctatatactctggcttatctggcatgtcatttgct
gaattttcttcagctatgccagttgctggatcagcctactcatatggtagcgtcatttac
ggtgaaattattggctggttacttggctggtccttaatattagaatactttttagccgtc
tctgccattgctactggtttttcagcctatctcaataacctgctcttaacctttggtgtt
catatgccaaagtcgttactggctggcccaatggaaggcggcatcgtgaatttatttgcg
gttatgatcattctccttgttaccgcgattttatctcgtggtcttaacgcttcaaagaag
attgaaaatggcgccgtcattttaaaagtagccatccttggtttgtttattattggtggt
tcatttttcattaagcatacaaactatgtcccattctatccgaaagaatttcacactgga
ctacttggtttaaatggtattatgtcagcaactgcaagtatcatttttgctttccttggt
ttcgacacaattgccgcacacgctgccgaagtgaaaaacccacaaaaaacaatggtacgc
ggcattgttggcacagttttaatttctgctttactatatgtcctattttcaatcgtgtta
actggtattgttaactataagcaactaggtgttgatgaccctgctgcttttgctctacag
gctattcatcagacacaattcgctgttgtgattacagttggtgctttggttggtatgttt
acggctattctagctttgatatatgcttcttccagactaacttattcctttggtcgtgac
ggcttgctcccacgttcacttggtaaaatttcaaaaagttcaagactacccgttaacgct
ttgcttgtggcagttgtgattgaggctatatttgctggtctaattcctttaaatactcta
gcgagtctgattaatgctggtacattactggctttcacattcattaactttggcgtactg
attctacgccgacgtccagatttggctcatgacggtttcaaagtacctggctatcctgtt
atcccattcatcgctgggataattagtctatatctcattactaagttaccaatcgatact
ttagaactatttagtatctgggtacttatcggcgttgcatggtacttcatatatggtatg
cgccattcaaaactatcatga

DBGET integrated database retrieval system