KEGG   Leuconostoc citreum: LCK_00293Help
Entry
LCK_00293         CDS       T00663                                 

Definition
(GenBank) Amino acid ABC transporter, substrate binding protein
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
lci  Leuconostoc citreum
Pathway
lci02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:lci00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    LCK_00293
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lci02000]
    LCK_00293
   02035 Bacterial motility proteins [BR:lci02035]
    LCK_00293
Transporters [BR:lci02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    LCK_00293
Bacterial motility proteins [BR:lci02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    LCK_00293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd Phosphonate-bd NMT1
Motif
Other DBs
NCBI-ProteinID: ACA82126
UniProt: B1MX74
LinkDB All DBs
Position
complement(308533..309327)
Genome map
AA seq 264 aa AA seqDB search
MKKITIAVITIVIILATAIGLARQQAHHKQASTDTILPNTLTIGLEGTFAPFSYRQDGKL
TGFEVDLSTAIAKKLDLKPKYVQTKWDSLIAGLGSKRYDVIFNDVGVTPERQQAYRFSTP
YLYAKTVLIKRKNNTQLNSLADLKGKKMAQSTTSNFGVLAKKSGAEIVAVPGMTEAMNMV
TTQRADGALNDLGAYATWQKANPDADTTAIDLSKESPAAPAAPLLAKNNKKLQQRIDQAI
ADLKQDGTLQKLSLTYFNADLTKK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatcactatcgccgtcatcactatcgtcattatattagccactgctattgga
ttggctagacagcaagcgcatcacaaacaagcgtcaactgataccatattgcctaataca
ctaaccattggattggaaggcacatttgcgccattctcatatcgacaagacggtaaactg
actggctttgaagtcgatttatctactgccattgccaaaaaacttgatttaaagcccaaa
tacgtccagacaaaatgggattctttgattgccggtttgggttctaaacgttacgatgtg
atttttaacgacgttggtgtgaccccagaaagacagcaagcttaccgtttttccacgcct
tatttatatgccaaaacagtcttaattaagcgtaaaaacaatacgcaactcaattctcta
gcagatctcaaaggtaagaaaatggcacaatcaaccacatcaaattttggtgtgctagcc
aaaaaaagtggtgctgaaatcgttgctgtccctggtatgactgaagccatgaatatggtg
acaacacagcgcgctgatggtgcactcaacgatcttggtgcctatgctacctggcaaaaa
gccaaccctgatgctgatacgacagccattgatttgagtaaagaaagccccgcagcaccg
gcagcaccattgttagcgaaaaataataaaaaattacagcaacgtattgatcaagctatt
gcagatttgaaacaagatggcacacttcaaaaattgtcattaacttacttcaacgctgac
ttaacaaagaaatga

DBGET integrated database retrieval system