KEGG   Lactobacillus casei LOCK919: LOCK919_0762Help
Entry
LOCK919_0762      CDS       T02729                                 

Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00105  alpha-glycerophosphate oxidase [EC:1.1.3.21]
Organism
lcl  Lactobacillus casei LOCK919
Pathway
lcl00564  Glycerophospholipid metabolism
lcl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lcl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    LOCK919_0762
Enzymes [BR:lcl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.21  glycerol-3-phosphate oxidase
     LOCK919_0762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 GIDA FAD_binding_3 Pyr_redox_2 3HCDH_N NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AGP67505
UniProt: A0A1S2ALH7
LinkDB All DBs
Position
complement(768742..770595)
Genome map
AA seq 617 aa AA seqDB search
MVFSNETRKQTIHQLKHTELDLLIVGGGITGAGVAIQAAASGIKTGLIEMQDFAEGTSSR
STKLVHGGIRYLKSFDVGVVADTVKERAVVQGIAPHIPRPFPMLLPIYQESGSTFDMFSV
KIAMDLYDRLAGVEGSQYANYTVTKDEVLQREPQLSADNLQGGGVYLDFVNNDARLVIEN
IKEADELGGLMASHVKAVGVLHNDAGQVVGLHVKDLLDDTEFDIHAKLVINTTGPWADKF
NALDDHEKHAPTLRPTKGVHLVVDGSRLPVPQPTYMDTGLNDGRMFFVVPREGKTYFGTT
DTDYTGDYEHPRVEQEDVDYLLKVVNKRFPESHMTIDDIEASWAGLRPLINDNGSSDYNG
GGANSGKVSDDSFTALIEVVNAYEDDQATRADVERAISKLETAHAEAGLSPSQVSRGSSL
HQATDGLITLSGGKITDYRKMAAGALALIRRILVDRFNVDAPAVDSKKLQVSGGHFDPTN
VEETMAFYIRIGVDAGLSEKDAQDLANRFGSNTSRVLTYAVDGPAPGLSLKETMSLRYSL
NEEMTLTPVDYLLRRTNALLFHAETLAELKQPVVDEMAQTLGWDDSVKAQQLAALNAAIA
DSQLAYLKTAPAPVHPE
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atggtattttccaacgaaacgcgcaaacaaacgattcatcagttaaagcataccgagctc
gacttgctcatcgtcggtggcggcattaccggcgctggggtggcgattcaagcagctgcc
agcgggatcaaaaccggtttgattgagatgcaggactttgcggaaggcaccagttcacgt
tcgaccaaattggtacacggcggtattcgctatcttaaatcttttgatgttggcgttgtc
gctgacactgttaaggaacgcgccgtcgtgcaagggatcgcgccgcatatcccgcggcca
ttcccaatgctgttgccaatttatcaagaatccggcagtacgtttgacatgttcagcgtc
aaaattgccatggatctctatgatcgattggctggtgttgaaggttctcagtacgccaat
tataccgtgacaaaagatgaagtccttcaacgtgaaccacaattgtccgctgataacctg
caaggcggtggcgtttatctcgatttcgtcaacaacgatgcgcgccttgtgatcgaaaac
atcaaagaagctgacgaacttggcggcttgatggccagtcatgttaaagcggtcggcgtg
ctgcacaatgacgctggtcaagtggttgggctgcatgttaaagacttgttggacgacact
gaattcgatatccatgccaaactggtcatcaacacaaccggtccatgggctgataagttc
aatgcacttgacgatcacgaaaaacacgcgccaactttgcggccaaccaaaggtgttcat
ttagtcgttgacggttctcgcttgccagttccgcaaccaacttacatggatactggctta
aacgatggtcggatgttcttcgtggttccgcgagaaggcaaaacgtattttggtaccact
gatacagattataccggcgattatgaacatccccgcgttgagcaagaagatgtcgattat
ctgctgaaagtcgtcaataaacgcttccccgaaagccatatgacgatcgacgatattgaa
gctagttgggctgggttgcgaccactgatcaacgacaacggcagttccgattataacggc
ggcggtgctaacagcggcaaagtttcagacgattcattcacggccttgatcgaggttgtg
aacgcttatgaagacgatcaagcaacccgcgccgatgttgaacgtgccatttccaaactg
gaaacagcacatgcagaagccggattaagcccatcccaagtttctcgcggcagttctctt
caccaagcgacagacgggctcatcaccctttctggtggtaaaattacagactatcggaaa
atggccgctggtgccctcgcgctgattcgccgtattctggtcgaccgtttcaacgttgac
gcgccagcagttgattccaaaaagctgcaagtttccggcggacattttgatccgaccaat
gttgaagaaaccatggccttctacattcggattggcgttgatgctggtttatcggaaaaa
gacgcccaagatctggctaaccgcttcggttccaataccagccgagtgctcacttacgct
gtcgatggccctgcgccaggattaagtctgaaggaaaccatgagtctgcgttattcactc
aatgaagaaatgacgctcacaccggttgattatctcttgcgccgaaccaatgcccttctt
ttccacgctgaaacactggctgagttgaaacagccggttgttgacgaaatggcgcaaaca
ctgggatgggacgactcggtgaaagcccaacaactggccgccttgaatgctgccattgcc
gacagtcaactggcctatctaaaaacggcaccagcaccggttcatcctgaatag

DBGET integrated database retrieval system