KEGG   Lactobacillus casei LOCK919: LOCK919_1214Help
Entry
LOCK919_1214      CDS       T02729                                 

Definition
(GenBank) Aspartyl-tRNA amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
lcl  Lactobacillus casei LOCK919
Pathway
lcl00970  Aminoacyl-tRNA biosynthesis
lcl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LOCK919_1214
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lcl03029]
    LOCK919_1214
Enzymes [BR:lcl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     LOCK919_1214
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     LOCK919_1214
Mitochondrial biogenesis [BR:lcl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    LOCK919_1214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AGP67916
UniProt: A0A1S2AXC4
LinkDB All DBs
Position
1189553..1191007
Genome map
AA seq 484 aa AA seqDB search
MDYFKTSIDQLHEQLRSGKVTSSQLVDETLAGINQLDAEVDAFLALNADGAKEKAAAVDA
AGIADDQPLAGVPIAIKDNIVTKGVVTTAASKMLANFNPIYDATVMQKLDAAGAINVGKT
NMDEFAMGSSTENSAFKTTKNAWDHTRVPGGSSGGSAAAVAAGEVIAALGSDTGGSIRQP
AAFNGIVGVKPTYGRVSRWGLIAFSSSLDQIGTLTRHVKDAAQLLNVIAGHDERDSTTAD
TPVPDFTAKIGQDIKGMKIALPKEYLGKGVDPAIADKIKAAAKQFEDMGATVTEVSLPHT
QYAVPSYYIIASSEASSNLQRFDGIRYGFRAKDVKNIEDVYVRSRSEGFGPEVKRRIMLG
TFSLSAGFYDAYFKKAGQVRTLITRDFEDVFKDYDLIIGPTTPTVAFKIGEKVTDPVTMY
MNDILTIPVNLAGLPAASVPAGFVDGMPVGLQLIGKHFDESTIFQVAAAFEAQNDYLAQI
PGGK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
gtggattactttaaaaccagtatcgatcaattgcatgagcagttgcgctccggcaaggtg
accagcagtcaattggttgacgagacattggccggcatcaaccagttggatgctgaagta
gatgccttcttagcactgaatgctgatggcgccaaggaaaaggctgctgcagtcgatgca
gccggtattgctgacgatcaaccactagccggtgtgccaattgctatcaaagacaacatt
gtcaccaaaggcgttgtcacgacggcagcgtccaagatgcttgccaacttcaatccgatt
tatgatgcgaccgttatgcaaaagcttgatgcagccggtgcgatcaatgttggtaaaacc
aacatggacgaattcgcgatgggctcgtcaacagaaaactccgcttttaaaacgactaaa
aacgcttgggatcacacgcgcgttcccggtgggtcgtcaggcggctccgcggcagctgtc
gcagctggtgaagtgattgccgcactgggcagtgatacaggcggttccattcgtcagcct
gctgcttttaacggcatcgtcggggtcaaaccgacatacggccgcgtttctcgctggggt
ttgattgcctttagttccagccttgatcagatcggaacgctgactcgacatgttaaagac
gctgcgcagttgctgaatgtgattgctggtcatgacgaacgtgatagcaccacagcggac
acacccgtaccggactttaccgccaaaatcggtcaggatatcaagggaatgaagatcgct
ttgccaaaggaatacttaggcaaaggggttgacccagcgattgcggataagattaaagca
gctgccaagcagttcgaagacatgggcgcgacggtgacagaagtgtcactgccacatacc
caatatgcggtgccatcttactacatcatcgccagctccgaagccagctccaatctgcag
cgctttgatggcattcgttatggtttccgcgccaaggatgtcaaaaatattgaggatgtt
tatgttcgttctcgatccgaaggttttggcccagaagtcaagcgacgtatcatgctgggc
accttcagtttgtcagccggcttttatgatgcatacttcaaaaaggcagggcaggttcga
actttgattacccgtgactttgaagatgtcttcaaagattatgatctgattattggaccg
acaaccccaaccgttgcgttcaaaattggcgaaaaagtcaccgatccagttaccatgtac
atgaacgacattttgacaattccggtcaatcttgccggcttaccggcggcatccgtgcca
gctggtttcgttgatggcatgccagtcggcttacagctgatcggcaaacattttgacgaa
agcacgatcttccaagttgctgcggcttttgaagcacaaaacgactacttagcacagatc
ccggggggcaagtaa

DBGET integrated database retrieval system